SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261856488|ref|YP_003263771.1| from Halothiobacillus neapolitanus c2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261856488|ref|YP_003263771.1|
Domain Number 1 Region: 371-564
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.77e-68
Family Pyruvate oxidase and decarboxylase PP module 0.0000133
Further Details:      
 
Domain Number 2 Region: 187-361
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.42e-66
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000547
Further Details:      
 
Domain Number 3 Region: 2-177
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.65e-66
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261856488|ref|YP_003263771.1|
Sequence length 566
Comment acetolactate synthase large subunit [Halothiobacillus neapolitanus c2]
Sequence
MELSGGQILVECLKAEGVEAVFGYPGGAVLHIYDALFQQEQVQHILVRHEQGAVHMADGY
ARATGKPGVVLVTSGPGATNAVTGIATAHMDSIPLVIITGQVPTSLIGNDAFQEVDSVGI
TRPCVKHNFLVKDVRDLAETMKKAFYIATTGRPGPVVVDIPKDVTDPRVLIPFEYPQSVS
LRSYHPTVKGHTGQIRKAIDLIVNAERPMIYSGGGVVIGRAAEQLTRFARLLNYPITNTL
MGLGAYPASDRQFLGMLGMHGTYEANMGMHHCDVLIAIGARFDDRVTGNLAKFCPTAKIV
HIDIDPASISKNVVVDVPIVGSVKSVLEEMLPLIEDAGGAKQKDAIAAWWSQIEQWRDMR
CLDYKTNGEVIKPQYVVQKVWEITKGDAFVASDVGQHQMWAAQYYGFDKPNRWINSGGLG
TMGFGLPAALGAKFAFPDEEVVCVTGEGSIQMCTQELSTALQYHLPIKVVSLNNRYLGMV
RQWQEFFYSGRYAMSYMEALPDFVKLAESYGHVGMRIEKASDVEGALREAFAMRDRLVFM
DFQTDPTENVYPMVPAGAGLNEMILV
Download sequence
Identical sequences A0A259RLV7 D0L201
gi|261856488|ref|YP_003263771.1| 555778.Hneap_1902 WP_012824757.1.355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]