SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271961811|ref|YP_003336007.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271961811|ref|YP_003336007.1|
Domain Number 1 Region: 66-159
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000392
Family Multidrug-binding domain of transcription activator BmrR 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271961811|ref|YP_003336007.1|
Sequence length 170
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MTPQLVDRGPVTCLSVTGRGEPGGTEHVSAIRALHTVAAVLNVQVGPLEGLWWVEDEQHW
TEAPRDQWRWHLLLSLPGAPEPGAADAARETARVSGAAVDRVQVVTFTEGQCVELLHEGP
YSEEHVSLKVMDDFMAARGLVRNGLHHEVYLSDFDDPAPRTLLRQPVALA
Download sequence
Identical sequences D2AZ79
WP_012887010.1.100029 gi|271961811|ref|YP_003336007.1| 479432.Sros_0224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]