SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271961846|ref|YP_003336042.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271961846|ref|YP_003336042.1|
Domain Number 1 Region: 296-462
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 9.16e-28
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00085
Further Details:      
 
Weak hits

Sequence:  gi|271961846|ref|YP_003336042.1|
Domain Number - Region: 31-80
Classification Level Classification E-value
Superfamily PKD domain 0.0275
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271961846|ref|YP_003336042.1|
Sequence length 463
Comment 5'-nucleotidase [Streptosporangium roseum DSM 43021]
Sequence
MGLSGSVGRRIGVLVAVIAMASGAFVSGAQAAPNPVVFGTASASPKAHTGACPATVTLST
TVKVKAPVALKYAWTFSDGDRSRAKTYKVGGKGLKTVRLSTSIKVTGDARGWGAVRLVSP
VKKTSGKASFAVTCAGDTESTGDVWDSVATSAEGSETPDVSATPPPAGQDDDKPAQNLVR
KATIVFERTTASKCPVTFKIHGHFEGLPAGAQAVQYRLVGTQEWKTVNVPADHGAVFTTV
LETFNWDWETDQTSVQIQIRQPDGLMSNTLYYFKCGPPSDKESFGATAEKITLTAAGGPL
VELVADAYLDAVQAVSGAQVALVSRYGFRAELNAGPVTYEELWATQPAGLAVDVNAMTGA
QLKKLLAHPNPSGWVLTPSSSLRYTLQGGAVTEITLNGTPVTDTQVIKIAANYILMGGWQ
GFPRWEGSTSVYHGGPDDTGALASYIVKNSPVRAPKGDRVTIR
Download sequence
Identical sequences D2AZB4
479432.Sros_0267 gi|271961846|ref|YP_003336042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]