SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271962354|ref|YP_003336550.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271962354|ref|YP_003336550.1|
Domain Number 1 Region: 44-95,247-484
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.31e-59
Family Bacterial dinuclear zinc exopeptidases 0.0000109
Further Details:      
 
Domain Number 2 Region: 162-210
Classification Level Classification E-value
Superfamily PA domain 0.0000000000249
Family PA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271962354|ref|YP_003336550.1|
Sequence length 514
Comment aminopeptidase Y [Streptosporangium roseum DSM 43021]
Sequence
MRLRRNLVRTVTLVTAVTLPLAFTPPASATTADIPDVLANALSSQVKGKNVKKHLDRFQQ
IADANGGTRAAGTPGYDASLAYVQDKLRRAGYKVSTTDVEFPVSWEEFSPSVLQQVTPEA
KSYANPADFVTVVSSSPGDVTAQVQVVDAVIPVPGTPNTSTAGCEAADFAGFVPGRIALI
QRGTCAFVDKATNAKAAGAAGVIFFNEGQPGRTDPFAFDIREWRFGFPIVFASTTVGLDL
ADTPGTTVRLKVDAKTTVGQTKNLIADSLWGKKGEVVMVGAHLDGVTEGPGINDNGSGSA
AILETALKLAYLPTKNKVRFAFWGAEELGLLGSDQYVAGLSQAERDKIRLYLNFDMIASP
NDVTFLYDGDDSDAEGAGAGPAGSAEIEKLFEKFYGKRGLGFKGTDFSGRSDYGAFIATG
IPAGGIFTGAEGIKTAEEAATFGGTADAPYDPCYHAACDTITNINAAALDRNSRAIGYST
AFYAYDLSTIPDRDAASLARSAAAAKRTPEDAAR
Download sequence
Identical sequences D2B694
gi|271962354|ref|YP_003336550.1| WP_012887553.1.100029 479432.Sros_0793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]