SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271963154|ref|YP_003337350.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963154|ref|YP_003337350.1|
Domain Number 1 Region: 27-225
Classification Level Classification E-value
Superfamily Phase 1 flagellin 4.05e-29
Family Phase 1 flagellin 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271963154|ref|YP_003337350.1|
Sequence length 237
Comment adenylate kinase [Streptosporangium roseum DSM 43021]
Sequence
MSDGNTTPGAGPADVGQYEARPNEVIRAARNASQALEFIRTTEGHLNELTNVLQRMRVLS
IQSANGTYSEEDRSVVQIEVDQLTDEISRVADQMNFNKMRMLTDASAAANVRAADELGMT
PAKINTPPSLANAQGAWTLRVHAGANTNEALAVNIFAANVANLFTAEGAPLDSKVALTAK
GPAPVGGKPAKPVNVMTASDANARIAKIDIAIKAVTDQKSDLNTLRDHLEGQARDAH
Download sequence
Identical sequences D2ARS8
WP_012888352.1.100029 479432.Sros_1615 gi|271963154|ref|YP_003337350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]