SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271963812|ref|YP_003338008.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963812|ref|YP_003338008.1|
Domain Number 1 Region: 34-316,380-424
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.64e-88
Family Type II chitinase 0.000000206
Further Details:      
 
Domain Number 2 Region: 318-381
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000565
Family Chitinase insertion domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271963812|ref|YP_003338008.1|
Sequence length 425
Comment chitinase [Streptosporangium roseum DSM 43021]
Sequence
MQRLLRNTLAAALAAGLTALAAPAPAQAQAHPDHGDRFKRVAYFVQWGIYGRNYHVKDID
TTGAAAKLTHINYAFGFVSAGGDCVSSDAWADWQRPVPADQSVDGVADAEGQALNGNLNQ
LKKLKAKHPGLKAMISLGGWSGSKYFSDAVLTAEGRTKLAASCVDLWLKGNLPGAAPGTG
AGVFDGIDLDWEWPGSSGADGNVIRPEDKRNFTLFTAELRRQMNEFDRKSELSAYLPAAA
AKIDSGFEVRELFRHFTFATVQGYDLRGSWETVTGHNGNLFADRRDPNTVKYSVDQTVRD
YLSRGAPARKIVVGVPAYGQGWTGVTGGGNGLFKNATGPAQGTWAAGVDDYENIVKKPGK
RYRDLRTGAAWIYDGNEFWSYDDPTTVAQKAAYIRLKGLGGSMMWSIDQDDSKSSLTSAL
YSVLR
Download sequence
Identical sequences D2AZM0
WP_012889010.1.100029 gi|271963812|ref|YP_003338008.1| 479432.Sros_2284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]