SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271963838|ref|YP_003338034.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963838|ref|YP_003338034.1|
Domain Number 1 Region: 26-333
Classification Level Classification E-value
Superfamily Aldolase 9.52e-100
Family HMGL-like 0.000000000603
Further Details:      
 
Domain Number 2 Region: 465-567
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 3.14e-36
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 401-450
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.0000000000000157
Family DmpG/LeuA communication domain-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271963838|ref|YP_003338034.1|
Sequence length 569
Comment 2-isopropylmalate synthase [Streptosporangium roseum DSM 43021]
Sequence
MYPQQQPSPMPFKRYESYAPVRLDDRTWPGKVIDRAPRWCAVDLRDGNQALIDPMDSHRK
LKMFELLVKMGYKEIEVGFPAASQTDFDFVRQIIEEGLVPDDVVIQVLTQARPELIERTF
ESIQGAATAIVHLYNSTSTLQRRVVFGQDREGITAIAVEGAKLCKKLADASDVDVYFQYS
PESFTGTELEYAVEVCDAVNEVWQPTPDRKVIVNLPATVEMATPNIYADQIEWMHRNLAY
RDSIILSLHPHNDRGTAVAAAELGYMAGADRIEGCLFGNGERTGNVCLVTLGMNLFSQGV
DPEIDLSDIDEVRRVTEYCNQLPVHPRHPWGGELVYTAFSGSHQDAIKKGFEHLERDAAA
AGVPVEEFTWAVPYLPIDPKDIGRTYEAVIRVNSQSGKGGVAYIMKADHQLDLPRRLQIE
FSRVVQARTDTLGGEVNPAQMFEVFTDEYLPNPVSPWGRLGLLAHRTVSRGDEKDAISVD
LRVDGEIREIEGVGNGPISAFCDALAGIGIQVRVLDYAEHAMSAGTDAKAASYIECEIGG
EALWGVGVDANTTTASLKAIISAVNRATR
Download sequence
Identical sequences D2AZP6
WP_012889036.1.100029 gi|271963838|ref|YP_003338034.1| 479432.Sros_2310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]