SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271963973|ref|YP_003338169.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963973|ref|YP_003338169.1|
Domain Number 1 Region: 270-746
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.45e-18
Family Glycosyltransferase family 36 C-terminal domain 0.068
Further Details:      
 
Domain Number 2 Region: 802-944
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000312
Family Galactose-binding domain 0.027
Further Details:      
 
Domain Number 3 Region: 973-1042
Classification Level Classification E-value
Superfamily PKD domain 0.0000288
Family PKD domain 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|271963973|ref|YP_003338169.1|
Domain Number - Region: 1277-1345
Classification Level Classification E-value
Superfamily PKD domain 0.0235
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271963973|ref|YP_003338169.1|
Sequence length 1363
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MPFPPHAWRRLTVIVTAALLTVTTLAPSRPAVAAQTIGLPTFGGPAIPAPPAAYTPGDMM
QTIYDAESSGTDFWMDRLLARSGNDPAGTWLMSRGRALFMKTHTPSVIGFGGQVAYWESI
SNENAYSIAISPGTFTEQVNRRWQAPSHWKSVHSSGNVQVNVTKFITDNNVAVTNLSITN
SGSSAQTLTLKAASPYTKTAAGDELTGIVDAKNKLTTLFPRLAGDGFTVSGTDLSRTVTV
AAGATVTTKVEMGFVTEEIPASLADYRAYRAATPADAFATHVRAYNLWWVKNVPYIDVPE
AAIKKSVYYRWWLMRFNYLDADIPGQDYQYPTSVEGALGYNNAIALTVPMFVDDLKYLRD
PMYSYGPWVSAGEVSKNGRYMDNPGDPENWSNSYTQYISEAAWRSYQIHGGQPAIAGNLA
RYAEQDVKGQLGHYDHDHNNLIEYDWGALTGNDADAVSFHWRGGNLDRTESAYVYSNALA
SAAAYDTIGNTAKAGEMRAIATNVKNAVVNVLWNPAAQMLQHRHVATNALVPWKEINNFY
PYAVGLMPNTATYRQALRLLDDPAEYPIFPFYTANQKDKAAAAAAGNPGSNNFSQINSTV
QFRLFSSALRNYPSSFVTADHYKKLLYWNAWAQYVGGDTAWPDSNEYWADWNGSAIGYRS
WIHHTILGSSNWTVVEDVAGLRPRDDSKVELSPINIGWSHFTVNNLRYRNSDLTIVWDDP
ADGIVRYPGVPQGYSVYVNGTRAVTVNSLVPLLWDPATGTVTTAGTVLHNVAVPGAQAPA
QVVQTGARLVDLFGKAGVNLTAGAVDLAQGRTATASFTASGTGTAGAVDGFTINEPFWGA
KGSANARDWYEIDLGSAQAFNDVRVHFRNDRSATGYAEPSMYEIQYHDGGAWVTVAGQSR
SPATPVANHNRVRFPSVTAQRVRVLMTHQTGVRTGLTEVKVFNTPGSPPASTNAAPYALA
RKDPAYNQPSQVRLIGKVKDDALPNGTLTSAWSLVNGPGTAIFTAPGSTTTLASFTVAGT
YTVRLTAGDGSSSTTSDVTVTVSQGTGGGGPVNVAGTAAPSASHTSPWESVAALNDGFTP
SSSNDSANPRWGTWPETGTQWAELTWAQPQRLNSAEVYFFDDNGGVRLPASWKLQYWNGS
AYADIPGTYPRALNAFNKVTFAGVTTTRLRASLAGGSGSVGILEWRAYAENPQSIRPVHK
ATLAGQIPTLPGTVTKIYSNGSRVNAPVSWAQITAAQVANGGSGFDVAGIVEGTTTAATA
TVWVRPTNAVSVTFLEPETVFTPAGTAPALPPTVTATFNDGSKDNITTTVTWASIPASQY
AQPGLFTVTGTVPGTSLTAQATVTVGASGGGTAGGATSAAPRR
Download sequence
Identical sequences D2B1G1
WP_012889171.1.100029 479432.Sros_2448 gi|271963973|ref|YP_003338169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]