SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271965040|ref|YP_003339236.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271965040|ref|YP_003339236.1|
Domain Number 1 Region: 356-664,791-821
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.15e-77
Family Type II chitinase 0.000042
Further Details:      
 
Domain Number 2 Region: 23-127
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.51e-18
Family Cellulose-binding domain family II 0.00069
Further Details:      
 
Domain Number 3 Region: 227-322
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000105
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 4 Region: 132-221
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000344
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 5 Region: 664-789
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000611
Family Chitinase insertion domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271965040|ref|YP_003339236.1|
Sequence length 997
Comment chitinase [Streptosporangium roseum DSM 43021]
Sequence
MAVVCAAATVGMTTVGTPVAHAAASLSAKFTAADRGTWWQGGYEVKNTGDTAATTWTLEF
DLNSGQSIGNWWNGTPTVSGGHVTVRPSSTNANVPAGGTTGGNSFGFVGMGPSTPPANCK
INGNPCEGGPPPDTPPTAPGRPVATPDITSVALTWTASTDDKQVAGYDVYQGGAKVRSVT
TSAATVDGLAADTEYTFTVKARDSANQESASSPATTVRTLKDPTPDTEAPTTPGTPVVTG
KSATGVTLQWGASTDNRVVTSYEVHNGDTLATTVTGTPPGTTTTVGGLTEDTEYTFKVRA
GDGAGNRSAFSGTVTVRTDRQPTDQSACRPDGLYRSPGVTGVPYCSVYDTDGREKMGADH
PRRVIGYFTSWRTGRNGAPAYLANDIPWDKITHINYAFAHIDGQGKVSVGTPGPDNPALG
MQWPGVAGAEMDPSYSYKGHFNLLNKFKKQHPGVKTILSIGGWAETGGYLDDNGVRQATG
GFYTMAGSQAGINTFADSAVKFIRDYGFDGVDIDYEYATSAPSAGNPDDFAFSNPRRATL
MAGYVNLMRTLRQKLDAAAAADGKYYLLTAATSASGWILRGSESYQVTPYLDYANMMTYD
LHGAWNQFVGPLQALYDDGTDAEMKHWNVYGTYSGIGYLNGDWAYHHLRGAIQSGRINLG
LGYYSRGWKGVTGGTDGLWGTSALPNQNDCPEGTGGKIGSTVPCGDGAIGIDNLWHDLDK
TGKEVPAGVNPVWHFKNLQEGRQGSYITQYGLTPDTDPADRLSGTYTRKYSSSMAAPWLW
NNDKKVYLSTEDDQSVQAKADYVVGKGLGGIMIWELAGDYAYHPGRDGGRGEYFIGDTLT
TKIYNTFRTAAPYGNLKAGTRAMPAQTLNVQAELYGFAVGDANYPISPKLKFTNNSTTTI
PGGATIEFDYGTSAPATMTQQTGWTLSIVSTGHTGPNTGGLKGDFHRVRLTVPTWESIAP
GQSKEVQLRYDLPIASPSNFTVTFGGQSYRMAFDNPR
Download sequence
Identical sequences D2AQU6
479432.Sros_3559 gi|271965040|ref|YP_003339236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]