SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271965255|ref|YP_003339451.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271965255|ref|YP_003339451.1|
Domain Number 1 Region: 818-944
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-25
Family Family 6 carbohydrate binding module, CBM6 0.00049
Further Details:      
 
Domain Number 2 Region: 684-815
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-24
Family Family 6 carbohydrate binding module, CBM6 0.00082
Further Details:      
 
Domain Number 3 Region: 42-209,243-331,402-481
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 3.14e-24
Family Soluble quinoprotein glucose dehydrogenase 0.005
Further Details:      
 
Domain Number 4 Region: 497-583
Classification Level Classification E-value
Superfamily PKD domain 1.31e-23
Family PKD domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271965255|ref|YP_003339451.1|
Sequence length 945
Comment glucose/sorbosone dehydrogenase [Streptosporangium roseum DSM 43021]
Sequence
MSPRSRPWIRTLATALLVTAGSLAIPTAHAARTAPAAQATAAIPPSDYQQVQLAVGAAKL
GEAMSLAVLPDRSVVHTARNGTVRVTDASGTTKVAGTLNVYTHDEEGLQGVAADPGFATN
RYIYLYYSPKLATPAGDAPKTGTEADFAAWKGHLNLSRFVLRTDGTLDLASEKVVLEVPN
DRGQCCHVGGDIDFDAAGNLYLTTGDDTNPFESGSFTPIDERTDRNPQFDAQRSSGNTND
LRGKVLRIRPTAAGGYTVPSGNLFAPGTAGTRPEIYAMGFRNPFRMSVDKATGVVYLGDY
GPDAGSGDANRGPGGQVEFTRITGPGNYGWPYCTGTNTPAETYNEFTFPDGPSGAKYDCA
GGPANNSFRNTGLARLPAAKPSWIKYGDAGSPPEFGGGSESPMGGPVYRYDANLDSAVKF
PASLNGRYFAGEYGRRWIKAIEVKADGSPGEIAAFPWTGTQVMDMAFGPDGALYVLDYGT
GSDNQALYRVEHIGGTNRNPVAKVTADRTSGPNPLAVAFSSAGSSDPEGGALTYSWRFGD
GGTSTQANPSHTYTANGTYTPTLTVTDPTGLTGTASVIVTVGNSAPSVSLASPGDGRPFA
FGDTVPFQVNVSDPEDGAVDCAKVKVTYLLGHDSHRHAITSRNGCSGSIAVPVDGEHDAA
ANIYGVFDAEYTDAGGLTTHSVRVLQPRHRQAEHFGAQSGIQPADHTAAEGARTAGFIDN
GDWISFQPYVLSGVRSASFRVSSAGAGGTIEVRAGSATGTLLGTAAVPVTGSWETFTDVT
ASISGAPAGSTTLFLVFKGPTGAGNLFDVDAFTLVTAAGTTAEAESYTSTSGVQIADHAP
ASGGRTAGYINNGDWTGYSTITTTGATAFSARISSAGPGGTIQIRSGSATGALLGTVTVP
TTGGWETFQNVTTPLTASATGPLFLVYTGTGTGFLFDVDTFTLTR
Download sequence
Identical sequences D2ATI8
gi|271965255|ref|YP_003339451.1| 479432.Sros_3787 WP_012890451.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]