SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271965261|ref|YP_003339457.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271965261|ref|YP_003339457.1|
Domain Number 1 Region: 22-331
Classification Level Classification E-value
Superfamily Aldolase 4.58e-95
Family HMGL-like 0.00000000584
Further Details:      
 
Domain Number 2 Region: 399-448
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.000000000000471
Family DmpG/LeuA communication domain-like 0.0009
Further Details:      
 
Domain Number 3 Region: 447-552
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.000000000301
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271965261|ref|YP_003339457.1|
Sequence length 579
Comment 2-isopropylmalate synthase [Streptosporangium roseum DSM 43021]
Sequence
MKTTTRQTGRYGAFTPVPLPGRTWPNNIIGSAPRWLSTDLRDGNQSLATPMSPDRKLAMF
ELLVSMGYKEIEVGFPVASQDDFDFLRVLIEQERIPEDVRISVLVQARDELIRRTVESLE
GAPRATIHLYNATSPLFRRVVFGMSRNECKDLAVQGTRLMMKYAEKTLGDCDLGFQYSPE
LFSDTELDFSLEVCEAVMDVWQPEPGRGIILNFPTTVERSLPNVFADQIEWLSRNLSRRE
HVCLSIHPHNDRGTAVASAELALLAGAERIEGCLFGNGERAGNVCLVTLGLNMFTHGVDP
GIDFSDINEIRRTVERCNGLAVHPRHPYGGDLVYTSFSGSHQDAIKKGFDALEREAAHRG
AAVGDLPWEMPYLPLDPEDVGRTYEAVVRINSQSGKGGVAYVMSAWHGLNLPRDLQIDFA
HVVQSQADAEGGEITPDRVKRLFEREYLSSSDLPVPLASGTELVTTSLHIDGERFDVGAD
RADTVQAVRATLTRWGFDVRAVHRTGIAGQDRGPDADVAVYAECRVEGRVSWGVGIDRDI
EAASLAAVRSAVIRARLKRLPARGGEATGIVAPLVAAGR
Download sequence
Identical sequences D2ATJ4
WP_012890457.1.100029 479432.Sros_3794 gi|271965261|ref|YP_003339457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]