SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271965721|ref|YP_003339917.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271965721|ref|YP_003339917.1|
Domain Number 1 Region: 482-693
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.95e-18
Family Bacterial lipase 0.014
Further Details:      
 
Domain Number 2 Region: 1834-1927
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000549
Family PKD domain 0.0057
Further Details:      
 
Domain Number 3 Region: 1700-1829
Classification Level Classification E-value
Superfamily PKD domain 0.0000000017
Family PKD domain 0.0062
Further Details:      
 
Domain Number 4 Region: 1916-2017
Classification Level Classification E-value
Superfamily PKD domain 0.0000122
Family PKD domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271965721|ref|YP_003339917.1|
Sequence length 2169
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MAGSLVLPTSAIAASAPEPPPNNEVASAAGEVKLIDLGSLNGRDDGVYSSLGYKVNARGI
NNMSQVVGTATVSHLNDHQRAVLFSGGSVRQLHDSLEGLGDGGIVNSHAWGINDDGTVVG
TFSDMGPDDEKTFVLKDGKATLIEQRFGRVINNKGQIGGGGWVRDPDGSVLQLRAFKDQN
MGVSALNNSGSVAGNADMDPDRSVFEIRAFRTKPGQPLDLAKDILQYAGETKAADINDKG
QVAGHGKNMNGGIVPIIWNASGVAVEQDTPLGGEAYAINNAGIAVGLMRTSSGPTRAAMY
AGGAGIDLNTLVPAGTNLRLTRALGINDLGQITGVATNTTTGVGHAFLLDLGLAKPVINS
VTLETKRYPSEEWGEAGAVTDGDPARITVSVTNPGSMPVSAQIRLYQAPNPGEAVDYTPL
PKVEPIEVELEPNQTVNVRANWDTAGVAWERGEANLVRYVKARLYMGGVRQGFAESAKIT
TRPKPVVLVHGWKSNAEIAWGYAHAILDGLHPYIGSFAVGNGEFGPDGGTLDTGDLSDSS
KQTNTLAENAKELAKYLENVRTRTGASHVDVIAHSMGGLITRQYIQTEMPSSPDHKPVVN
RMLQMGTPNRGTPCADMVVLNATLTDGSVPFSPATEQNTTRFVRGVFNQQYTNLKGVTPS
NLAGVGRPLPCVAPPEHTEFYDSDLIVPLWSARFYPDVPRTGTVHMSMTDSAWDFETYVK
PRLASVPGKDGDPDLPRLTKGVTGDSAMAAAPAAMATDDGGTDAGSVFAASSTAVEAGKT
VSVPLDVPQGSAFGVTGALPSTVGLVLRNPSGEPAAQYAAGSDEAKQPVQGLSVAKPRAG
AWKLEITNSATEPVTANLGAWVAGNPVKVAATVEQPSEDGRVKVTGTVTDAGKPVTAVPV
QAIVIGEDGARVELSLKDDGNSGDGGAGDGVYGATSESLADGVYSVTVKADTAKGLRAAL
DVVEVKKPDLREFELTLSAQPGGSVAVSPAQDTYRAGTKVTVTATPEAGRIPIGWTVDGE
ERGAGALRLTMNGPHTVVARFGTYTVTELGAASPGRSAAETRAVALNDRGQVAATVDQNH
THRTSAVRWQAGEFTNLGDLPCTDDPRSTNRCMAVATGINEAGDVSGWATSGEGGTNRAV
VYRKDGSVRSLQPESGGLALGLNDNGQVFGMAGGDHVIWDQGGAVQLPANPVFDTKYTYV
SGYASAFSSRINARGTVAGNYVMGRDPIYGKPVNWGPALYRDGVTTPLAVPGCPYKDNEY
GDAYDVNTAEVVAGSVDCGPNNPTRAVLWKDGQPTELGEGEATALNDHGLVVGRALDQDA
STPVKTIWEPVIWLEGEKYALADLLPRPLCPREQENTTGPCMGLDRLYDVNSSGQIVAQG
FIRDRSTTDPTGFSTHARSFLLTPTTARADLEVKQTVSATEPGPGSTVTWTTTVTNKGDD
TATDVRLDILIPQAVTGATCDTWRGICTAIKGGFRNTAKVLEPGRSATVEVSATVPDNAA
NGTELKAGTGGYSLAVTDPKPADNTASTTATVRPLLIPSGINWTDPVEVGQVSYPSSVTL
TNRLNDPIPLKVIAVSGPFTQSNACPVELAVGKACTVEVKFAPTAEGPATGALTFTTADG
AAPAYTVPLTGKGIKAGDIPAVQAPAAPLRGQVGKPFTLRVDFTDTEAGDTHTAKVAWGD
GPPVDAVVTPRPGGGTVTLTRTFTAPKSGTAMVMVYDSSNNLGDAGVPYVISEAAPNTAP
VVTAGADVELTAGEVLQRTVTFADPDSTSWTATVDYGDGSGPQPVTPNAAKQITLEHQWA
TPGTYPVTVKVKDDGDLETTATFIATVVAAETPNQAPTVRVSPAFDTVEAGAVWVAPASF
TDSDSTSWTYMVDYGAGAGPQPLSKVAGQLKLEHVYASAGDYTVVLTVTDDKGASGSAQV
TVHVTNAAPEVALTAPAVAKQPAKVAKVGEAVSLSASFTDSGKADTHTATWSIGGEPVPA
AVAGHGGKGTVSGSHVFTKAGLYPISVTVTDNHSGATKADTADGKQAYVVVYDPAGSLVG
AGQTVSPAGVCKLDAACAKEGEANLNVTAHYRDKDTTPTGELHYNAPGFDLRDDSSTVLA
VAGGTAILRGEGKVNKTVDVTYEITTIDSGKPADNTDQLVVRVWKKNGELIYDNSGKPAP
VSGVIRVSG
Download sequence
Identical sequences D2AZU0
WP_012890916.1.100029 gi|271965721|ref|YP_003339917.1| 479432.Sros_4284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]