SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271965747|ref|YP_003339943.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271965747|ref|YP_003339943.1|
Domain Number 1 Region: 213-505
Classification Level Classification E-value
Superfamily Subtilisin-like 1.7e-81
Family Subtilases 0.00000473
Further Details:      
 
Domain Number 2 Region: 804-901
Classification Level Classification E-value
Superfamily PA domain 0.00000000000405
Family PA domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271965747|ref|YP_003339943.1|
Sequence length 1253
Comment peptidase S8/S53 subtilisin kexin sedolisin [Streptosporangium roseum DSM 43021]
Sequence
MPIRRRAALLSVSLAATLVAAGTGSAHGESPAPGDGVAGIPAPSAITARVTLITGDQVAV
TSQAGKTVSVNVTPYNRSISDIRTFTVGTDVYVMPKEAEALVGSGQVDKRLFNVTQLIAQ
GYDDAHSESIPMIVRYSEKAAKKAGEPSAPDGGRITRRLPGVRGAAVSADKKQGDTFWEA
VDDDTSKAGTPTTQLSGDIQRLWLDGKVKALLDRSVPQIGAPEAWAAGYDGAGVKVAVLD
TGADLRHPDLVDRIADSRSFVPDEAVQDGHGHGTHVASTIAGSGAASGGKYKGVAPGAKL
LVGKVLADGGAGMESWILDGMTWAAHSGAKVVSMSLGGQEGADGTDPMAMAVNQLTAETG
VLFTIAAGNSGPGATTVGSPGAADAALTVGAVDSADAVTDFSSRGPRGGDGALKPEITAP
GFKIVAARATGTSMGTPVDDTYTTASGTSMATPHVAGAAAILAQEHPDWTAARLKSQLIS
TAKTTAGTPVHSQGAGRVDVSRAVRQPVHGPGVIDFGLADWDSGSGPATKQIDYVNDGDQ
PVTLALSAKGAGEDLPAGALTLGAETVTVPAHGTAAASVTVDTAATAAGAHGAHVTATSA
DGQTVVTTAVGFVRDVERFDVTLKVLDRDGKPTTGVAVVHDFSLGKLGLPDMHVPGEDGT
VVARLPRGEHAFMAEIFHYSADGNRVWEYTYGGEPGTLIDSDRTITFDGGKAGPVTIDTP
KPNQTDRLRLGLAIQNSTDTNAFGVEQWMNGETKVYSIPSQVTSSHFESRVGWSLSAPEL
RAQVVGRGGGPIEPVYFRGRAGSARIDGTRVLRVADAGTGRPQDYAGQAVQGRLALVKRS
ADLTPQQQVDNAAAAGADAVVIYNDNPGNWGADNWSVTATKIPAMTISGTQGARLAELAA
RGRAKVELTGTAVSPYSYELLKYRQGGIPADQRYRVRTDELATVESSFHASVPGTEAGYS
RLMVSPMQTVAYLLFNRIVMPRPLTQYVTADVKTWEAMQVGTVWEAGQAGQQTAPTVLKA
GQRVSRDWNKAVVRTALPSGLDKSAYRDGAVAVVYAGGLSDTVPDQWFMSRAFTDKERTT
VYRNGELLGSAPSAVVAFPVVPERAEYRLVVDAQRDQPWWTTSTKVNTDWTFHSEEAGAG
TPLPVLSVDYDLDVDQANSASVKSATRVGLGLRYPKGKAGPRITEAKLWASYDDGTTWQQ
VRLAAKGDAAFTGTIRNPASAKAGGSVSLRAQATDADGNTVLQTVTRAYRLQR
Download sequence
Identical sequences D2AZW6
WP_012890942.1.100029 gi|271965747|ref|YP_003339943.1| 479432.Sros_4312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]