SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271966010|ref|YP_003340206.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271966010|ref|YP_003340206.1|
Domain Number 1 Region: 224-512
Classification Level Classification E-value
Superfamily Subtilisin-like 6.55e-83
Family Subtilases 0.00000366
Further Details:      
 
Weak hits

Sequence:  gi|271966010|ref|YP_003340206.1|
Domain Number - Region: 821-908
Classification Level Classification E-value
Superfamily PA domain 0.000915
Family PA domain 0.019
Further Details:      
 
Domain Number - Region: 1148-1302
Classification Level Classification E-value
Superfamily Sialidases 0.0392
Family Sialidases (neuraminidases) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271966010|ref|YP_003340206.1|
Sequence length 1340
Comment Subtilisin-like protein serine protease-like protein [Streptosporangium roseum DSM 43021]
Sequence
MVLGTLVAPGTAAFAQKQEPAPAAPATGPVTGPIALTGLGQGDRTVTLITGDKVRLSDAG
GGKYAVRPEASVRPDGTSAQLSTLATPKGVYVTPSDAVPAINAGRLDRELFNVTYLAENG
YTDDKTKQLPVIVQYPRQHTDKAVASAAKAIPASEPVLTLESVNASALQVTKAEAGTFWN
AVRAVPDKKSANGIAGPANVPDTLRGDIAKVWLDGKVKADLAESVPMIGAPQAWAGGHDG
AGVKVAVLDTGVDAKHPDLADRIVDSRSFIPGQEVQDGHGHGTHVASTIAGSGAAGGGKH
KGVAPGAQLIVGKVLANEGSGSDSQIIEGMEWAAASGAKVISMSLGGGASDGTDPMSQAV
NVLSASTGALFVIAAGNAGASGAETVATPGTADAALTVAAVDKSDAWATFSSQGPRVGGG
LKPDIAAPGVAIAAARAAGTTMGTPLDEHYTAANGTSMATPHVAGAAAIMTQQHPDWTGP
QIKAALMSTAKDDALSVYKQGAGRVDVARAYTQQVFAVTTGADFGAVESDAAPVTRELTY
TNLGGRPVTLTLTPGLRKSDGSAVEGGLSIAETTLTVPAGGTATTTATVDPKTLADLDNY
TGAVTATADGVQLRIPVGVVREVPKATLTIHTLGRDGKPRSPLAQDTIDVSGDKGVLGGV
ALTAEGTTVTRVPQGVISVTQVLSWVGDDERGNLAFLSVPELTVTGDTEITLDARKLTEI
RFTTPQPAEPLSNVPYLAYQRTVSNGTPYMGFTWPDRTWSRLWALPTEKVTKGAFRFHTR
FTLGRPEVEMSIRGRGGLTLHPVSALHGINTYGVHEQYDGFPDFRPFTGTRDLEVVDVGE
GRPEDIAGRDLRGKLVLMEAPMSEGLSGPMCGVQIERIGPIRDAGAAAIAYFPQPGTGCA
IPLSITQIPFTGEAKPIGVPTVSLPSREGVGLRDRLAGGKPVTLRVTGTEESPYTYTFAP
YEEGRVPRSLHYTFAERDLARIDVDTHTVAPARYNDWRYAQKPDDVMPMSTSVSAWGGPR
LTLQERRDWVGPLDSGVLWSHGMEEMRSTPADARVPQWALEVFDKPVRTRQSWLTTPFTP
GVATGSDKVYKLAKPGANLGWFFRCMLCVQGDRLWAEFEPSYGSPGTRKYNGGYWPTDDL
TKPGFDVRLWQDGKEIPRTSTGGTTILPVFTLPEGPGSYRLTAKNDRHDAEWTFTAPVKA
ERLPGSFCSLEALYGTAEPCKPAPVVFVSYDLGDTLDAANSVRAGRTHTFTVSPYHSPSA
SKMPDIAGLKLWASTDDGATYTPVSVKRDKDGTYTATTRYPALQQTKGAVTLKVEAWDKA
GNTVKQTTVRAFNLRGHAAG
Download sequence
Identical sequences D2B3E7
gi|271966010|ref|YP_003340206.1| 479432.Sros_4602 WP_012891205.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]