SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271966435|ref|YP_003340631.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271966435|ref|YP_003340631.1|
Domain Number 1 Region: 254-304
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000419
Family AraC type transcriptional activator 0.013
Further Details:      
 
Domain Number 2 Region: 201-251
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000436
Family Tetracyclin repressor-like, N-terminal domain 0.07
Further Details:      
 
Weak hits

Sequence:  gi|271966435|ref|YP_003340631.1|
Domain Number - Region: 24-75
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000678
Family Hypothetical protein TM1112 0.078
Further Details:      
 
Domain Number - Region: 38-100,128-173
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.00994
Family Regulatory protein AraC 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271966435|ref|YP_003340631.1|
Sequence length 307
Comment helix-turn-helix domain-containing protein [Streptosporangium roseum DSM 43021]
Sequence
MDVLSDVVAFMRCGRPTSARVSWRAPWGVSFRAAPGSAGFQVMLRGSCWLIPPDGEPVPL
SMGDLVFLPHGTTFALADDPARPLVESDCDPHSELFASADLGGTGAETVILSCGYRLNPD
RTHPILGSLPGVIHLPATLGSHPELRAAVGLLAAEIDTPRPGTDTVVSSLLDMLQLYVLR
AYFETQDEPCTLSGWAAALADPAIGRALDAIHRDPARRWTVESLGAHAGMSRAGFARRFT
GLVGQPPLAYLTWWRLASGARMLRESDASVAEVAERVGYGSEFAFGNAFKREFGVAPGRY
RRRVAVA
Download sequence
Identical sequences D2BA63
479432.Sros_5103 gi|271966435|ref|YP_003340631.1| WP_012891625.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]