SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271967051|ref|YP_003341247.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|271967051|ref|YP_003341247.1|
Domain Number - Region: 59-124
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0572
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271967051|ref|YP_003341247.1|
Sequence length 129
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MQFSRLLPTLMLGAVLTGCGGAGAAAPAVTVTTPQPAPLAGDAGDGPAKTGRTAPERKTL
PDVVGMNLQQGQDTMQAVGFYHLDDQDSTGQDRLQIYDRNWVITKQEPAAGRTVPTDTPV
ILYAKKYGE
Download sequence
Identical sequences D2ASI1
WP_012892241.1.100029 gi|271967051|ref|YP_003341247.1| 479432.Sros_5756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]