SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271967085|ref|YP_003341281.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271967085|ref|YP_003341281.1|
Domain Number 1 Region: 216-505
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-83
Family Subtilases 0.00000489
Further Details:      
 
Domain Number 2 Region: 826-923
Classification Level Classification E-value
Superfamily PA domain 0.00000000222
Family PA domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|271967085|ref|YP_003341281.1|
Domain Number - Region: 1217-1238
Classification Level Classification E-value
Superfamily Sialidases 0.0844
Family Sialidases (neuraminidases) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271967085|ref|YP_003341281.1|
Sequence length 1285
Comment Subtilisin-like protein serine protease-like protein [Streptosporangium roseum DSM 43021]
Sequence
MRRWVATAVALTAACAVVPGVPASAGPIRAPAGSAPVSQLTTAPDTYDVTLVTGDRVHVT
ELGDGRRTATITAAPRADGSTPAFQTLETGGRLSVVPDDVASLVPRRLDPQLFDVTALAE
QGYADPASGTLPLILTYTEPASLAAAPAIPATEPTRRLESIGGSGATMDKKQAAQLGAAL
AELARTGGGSGDRRLSGPLAGVEKIWLDRRVEAVLDRSVPQISAPAAWAAGYDGAGTTVA
VLDTGFDSRHPDLAGKIADERDFTGEDSVRDTQGHGTHVASTIAGSGAASGGRLKGVAPG
AKLLNGRVLNGDGEGAVSWIIDGMEWAATDKHADIVNMSLGSPEPGGPLTEAVDSLTERH
GTLFVIAAGNLGCDGCVGSPGDAPAALTVGAVDAEDRLAEFSSRGPVGPDGAVKPDVTAP
GVGIVAARAEGTSLGEPVDASHTRLSGTSMATPHVAGAAALLRQARPGIRAGELKALLMG
SARHQEGNSVDEQGSGRVDVAAALADPVVASLGSVNFGTVESPATGAAPVTRKVSYRNVS
GAPVPLNLRSTGAFTVSPATLTVPAGGSAEAQVSLDAAKVPEKRLREELVATTAQGRNVR
TLLTADVREARVELRVSGIARDGRPARGGFTVLNLDDGTLAGRLLPGDAAAPCTDERYGS
GTCLRVRPGSYSVLGHIFTAPSWQDSTESGQVLNESLVGDPEMTITEDTEVVLDARKAVE
VRVETPDHRTKRNTGAAEHLLWYRAPAEGEGALRGGTLIRPGAQLEERLFIQPTRRVTKG
MFSVATRWRLDAPAITMRALGITLNPEYYDPTWFSDLSPEFPRLDGPALLQLADAGQGRP
EDLKGRDLRGKLALIRRTDGIPVATQSNDAAAAGARMVAIYNDRPGVDTAPGGSGVKLSV
PTVRLSQEEGRKLLSRLRHLPVPVLAEGVVASPYQYELFLREKGRVPEKLHYVVRAKSLA
REETDFYSQLADDVTVNEARWAFEPWDATSLTTNRPVHRTPRTQVTYVTPDPEVRWNSAA
GAPELPYNHMWEHAPTPRVELSAPDLRPYREGERSHRTWFRQPLVPGVNPHSPLRRQGDT
LRISMQGFVDAGGNFGPAYTSDFEQGLRTDFRLYRGTTLIGQMTGLPSARATLPPEKSDY
RIEYEIENRATWAKLSTRTKTAWTFASEHTADGATGVIPLLLAGYDVPVDLKNRGAPASL
GLTLRHQPGAPTSAIKDVSLEVSYDDGATWRAVRRLTPTGGGSYKALLERPAPGAGAVSL
RLRASDAQGGGITQEVIRAYALPGR
Download sequence
Identical sequences D2ASL5
WP_012892274.1.100029 479432.Sros_5792 gi|271967085|ref|YP_003341281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]