SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271968099|ref|YP_003342295.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271968099|ref|YP_003342295.1|
Domain Number 1 Region: 68-385,501-552
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.48e-75
Family Type II chitinase 0.0000229
Further Details:      
 
Domain Number 2 Region: 716-763
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 1.18e-16
Family Carbohydrate binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 810-852
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.00000000000068
Family Carbohydrate binding domain 0.00039
Further Details:      
 
Domain Number 4 Region: 377-491
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000366
Family Chitinase insertion domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271968099|ref|YP_003342295.1|
Sequence length 855
Comment chitinase [Streptosporangium roseum DSM 43021]
Sequence
MSSRLRAGLAAAGASLALIAGALAGTAAAAADDESCRPDGLYTTPGLSVPFCQVYDEAGR
EKMGAGHPRRIIGYFTGWRTGKNGQPSYLAKDIPWGKITHINYAFAHVGPDNRISVGTDG
PDNAATGMEWPGIDTLDPALPYKGHFNLLNKYKKANPDAKTLISVGGWAETGGYFDASGA
RKPSGGFYTMTTNADGSANTAGINAFADSSVEFVRKYGFNGVDLDYEYPTSMKDAGHPLD
WQVANARRASLMKNYAVLMKTMRDKLNAASVADGKYYMLTIAAPSSGYLLRGMETFQVTQ
YLDYVNIMSYDLHGAWNEFVGPNAALYDDGKDAELAKWNVYNTEAYGGLGYLNTDWAYHY
FRGAMQAGRINIGVPYYTRGWRNVTGGVNGLWGTSKSTGGCPTGLTSCGDGARGIDNLWH
DEENNTEVSGGGNPLWHAKNLQDGRVGSYGPAYGLDPADPEDRLTGTYTRNYDSTLVAPW
LWNSTKKVFLSTEDDQSIGVKTDYVKDRGIGGLMIWELAGDYGWDAPKGEWFMGNTLTNQ
MYDALKTATPYGATRAKVAVPNEKLDVGVEIGGFPVGDSNYPITGKLKITNRSATTIPGG
AEFQWDYASSAPKNAKDQSGFGVTVISSEHGAGNNIGGLKGDFNRISFKLRANEPLAPGA
SLNMDYVYYLPAPAPANFTVSFGGRTYGLTADHARGGVIVNPTPTTGPTGGPGGDCSAPA
WSATQVYTGGNKVSYKGRQWEAKWWTQNNEPGTNDVWKDLGACATPSPTVTPTPTATPTV
TPTATPTPTPTPTPTVTPTPTVTPTGAYPAWKAGTAYTTGTRVSHSGADYECRQPHTASA
GWEPSNVPALWLRLS
Download sequence
Identical sequences D2B727
WP_012893283.1.100029 gi|271968099|ref|YP_003342295.1| 479432.Sros_6846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]