SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271968121|ref|YP_003342317.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271968121|ref|YP_003342317.1|
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Cgl1923-like 3.66e-85
Family Cgl1923-like 0.00000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271968121|ref|YP_003342317.1|
Sequence length 302
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MFDPTDLYRLSGDVPELTDPVLLYHFDGFVDAGGAGRLAIGHLLGELEHRVVATFDVDRL
LDYRSRRPIMTFDTDRWVSVESPEIALHLVQDSTGTPFLLLTGPEPDREWELFTAALGTL
ATRLKVSKLVTTHGIPMAVPHTRPLGVTGHATRPELVTGQTSAFGKVQVPGSVAALIEFR
LGAEGHDALGYAVHVPHYLAQAEYPAAAVTALEAVTRSTGLVFPLESLREAARSTDTEIA
EQIEASDELSTAITGLEQQYDAFAAGSKRENLMAEPSEMPTGDELAAQFEAFLAERDEQR
GD
Download sequence
Identical sequences D2B749
479432.Sros_6868 gi|271968121|ref|YP_003342317.1| WP_012893305.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]