SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271968812|ref|YP_003343008.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271968812|ref|YP_003343008.1|
Domain Number 1 Region: 426-740,811-842
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.22e-87
Family Type II chitinase 0.0000000238
Further Details:      
 
Domain Number 2 Region: 239-407
Classification Level Classification E-value
Superfamily Fibronectin type III 6.66e-25
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 3 Region: 132-233
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.07e-17
Family Cellulose-binding domain family II 0.0035
Further Details:      
 
Domain Number 4 Region: 38-126
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000000000307
Family Cellulose-binding domain family II 0.0036
Further Details:      
 
Domain Number 5 Region: 742-813
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000211
Family Chitinase insertion domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271968812|ref|YP_003343008.1|
Sequence length 854
Comment chitinase-like protein [Streptosporangium roseum DSM 43021]
Sequence
MRRTASVLLVLVLATALAAISAPANAAARLTAAFTLAGNQGKFVVSNPGATPVTGWSITF
DLPAGVTVSGAQNATTTQSGTRVKLTPAFYINTVRANGSTEPYSPTFTLSSAVQPTSCTI
NNANCDGSGDPPPPDAPVTATYSGSGTQGKYVVNNNTDAALNGWSITFDLPAGVTASGAE
NASISQSGRQVTLSPAHYNTTVAARGSTEPYSPSFRLSAAAEPENCRVNDVRCDGSADTP
PAAPGNLRSPVKTTKTVSLAWDAATPGSLPIVGYQVYNGATLATTVTGTATTLTGLTPNT
EYTFTVKTKDRKGTLSPASTALKVTTNNAGDDTQPPTVPANLRSTGKSSSSVSLAWGAST
DNKGIAGYEVYVGATLAATVTDTSATVSGLSPSTEYTFTVKARDLYDNLSAASNALKVST
DDIVGSGYARVGYFVQWGIYGRQYFVRNLDTTGAAAKLTHLNYAFGNIDPVNLTCLQGVT
KGTTANPQDPNQGDGAGDADADYGRPMSAAQSVDGVADTGWEKLRGNYNQLRKLKAKYPN
LKVLISLGGWTYSKYFSDVAATDAARKKFVSSCIDTYIKGNLPTYNAAGGPGSAAGIFDG
IDLDWEWPGAEGHAGNHIGANDKANNTLLIAEFRKQLDALTQETGKRYQLTAFTPADPAK
IEAGWDLPEVAKSLDIFNVQGYDFHGAGSDNSWEPNRAGHQGNLYADTDDPYSFHFSVEN
AVNAYLQAGVNPRKITVGLAYYGRGWQGVADGGKSGEWQSATGAAPGQFPDEAGTRGYSN
LLAGVPGCTIKHDEQSVATYCFTGNGGQWWTFDDAWSIAKKTAWLRSKGLLGVMIWEMSG
DPGTLTSAVDAGLR
Download sequence
Identical sequences D2BFV4
WP_012893995.1.100029 gi|271968812|ref|YP_003343008.1| 479432.Sros_7591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]