SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271969203|ref|YP_003343399.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271969203|ref|YP_003343399.1|
Domain Number 1 Region: 5-198
Classification Level Classification E-value
Superfamily DhaL-like 4.97e-36
Family DhaL-like 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|271969203|ref|YP_003343399.1|
Domain Number - Region: 412-472
Classification Level Classification E-value
Superfamily PUA domain-like 0.0164
Family Hypothetical RNA methyltransferase domain (HRMD) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271969203|ref|YP_003343399.1|
Sequence length 521
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MLQVLDPPAVRQWSRLAAETLGKAREEIDALNVFPVPDGDTGTNLHLTMLSAAEALDGLP
GDADAATTWQALAQGALLGARGNSGVIVSQALRGLAEVLRATEGRGADLGLGLVRAAELA
RAAVARPVEGTVLSVLTAVAGAVRDLTGDLASVARRAADEARSALRRTPDQLDVLARSGV
VDAGGAGLAIILESLAAVITDSYTGRVDIPAPTHRVAPEPEEGPGYEVMYLLDAGEAAVG
ALRRELDALGDSLVVVGGDGLWNVHVHVDDAGAAIEAAMRAGRPHRIRVTYLVGSGRTHP
AARGRGVVAVAAGPALGAVFEQSGAVVVRREPGSSPPLAAVLAAIREAGAEVVVLPNDSG
TREVAAAAAEIAREEGLMVSVLPTRASVQGLAALAVHDPLRRFDDDVVAMTEAAAHTRHG
HVWVADREVMTSAGLTAPGDVLGVIDGDAAVIGADLVGTALEITRRMVSSSSELVTMLEG
VNAPEGLARAVQDHLARIRPDVEVVLYEGGQGGYPLLIGVE
Download sequence
Identical sequences D2AVL0
gi|271969203|ref|YP_003343399.1| 479432.Sros_8001 WP_012894386.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]