SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271969369|ref|YP_003343565.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271969369|ref|YP_003343565.1|
Domain Number 1 Region: 161-427,487-531
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.41e-83
Family Type II chitinase 0.00000585
Further Details:      
 
Domain Number 2 Region: 23-126
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.6e-28
Family Cellulose-binding domain family II 0.00055
Further Details:      
 
Domain Number 3 Region: 429-488
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000763
Family Chitinase insertion domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271969369|ref|YP_003343565.1|
Sequence length 532
Comment endo-chitinase [Streptosporangium roseum DSM 43021]
Sequence
MTIGSLIAAAALLVPLGMSTATAATPATATYSTASDWGSGFEGKVTVKAGTSALTSWKVE
FDLPAGSSIASAWDADLTRSGNHYTFVNKAWNGALAAGASVSFGFNGAPGGLSGVLDCKL
NGAACNGTGTPDPTPTPTVTPTVDPTPTPTPTVTPTVGPDPSGKKVVGYFTEWGVYGRNY
HVKNLVTSGSAAKLTHILYAFGNSAGGRCSIGDSYADYEKAYTADQSVDGVADTWDQPLR
GNFNQLRKLKKAYPNIKVIYSIGGWTWSGGFTQAAANPAAFADSCYKMVEDPRWADVFDG
IDIDWEYPNACGLTCDASGPAAYKNVLSALRAKFGPSALVTSAITADGSTGGKMDVADYA
GGAQYLDWIMPMTYDFFGSWDAKGPTAPHSPLTAYPGIPKDGYNSDAAIQKLKGKGVPAS
KILLGIGFYGRGWTGVTQATPGGTATGAAPGTYEAGNEDYKVLKTKCPATGTIGGTAYGF
CNGQWWGYDTPATITGKMTYAKNQGLGGAFFWETSGDTANGELISAISNGLK
Download sequence
Identical sequences D2AX95
gi|271969369|ref|YP_003343565.1| 479432.Sros_8171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]