SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271969567|ref|YP_003343763.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271969567|ref|YP_003343763.1|
Domain Number 1 Region: 16-292
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.37e-63
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271969567|ref|YP_003343763.1|
Sequence length 545
Comment cytochrome b subunit of the bc complex-like protein [Streptosporangium roseum DSM 43021]
Sequence
MSSGTVPKPIASTSSFIDDRIGAGNFLKRNLRKIFPDHWSFLLGEIALYSFIVLLLTGTF
LTFFFKPTMAHVVYDGSYEPLKGVMMSEAYASTLHISFDVRGGLLMRQMHHWAALLFVAG
MMVHMLRVFFTGAYRKPRELNWLIGVGLLTLALFEGLTGYSLPDDLLSGAGLRITEGVMI
SLPLVGTWITFFLFGGEYPGEDVVSRFYSLHILLIPGILLGLITAHLMLMWVQKHTQMPG
KGRTNTNVVGAPLYPAFMAKSGAYFMFTFGAIALLGTFAQINPIWLFGPYSPADISAGSQ
PDFYMGFLEGSLRLMPAWEINFLGFTLPLSVLIPALVPMGIVMTGLALYPFIEQWVTGDR
SEHHVAERPRNNPHRTSIGISAVTFYGVLWLLGANDEISAFFHVSLNWTTYVGRVLVFVG
PAVAYFITYRMCLGLQRSDAAVIGHGVESGVIKRLPSGEYIEVHVSPNEAIEAHMRGKTA
IPVITGTSADSDGIPPKGMRGPLGKLRAKLSKAYGGEKIPLDGEHPHEEHAAVGSDVKKD
KSLPS
Download sequence
Identical sequences D2B0K8
gi|271969567|ref|YP_003343763.1| WP_012894749.1.100029 479432.Sros_8374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]