SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271962487|ref|YP_003336683.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271962487|ref|YP_003336683.1|
Domain Number 1 Region: 353-979
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.24e-292
Family Cellulases catalytic domain 0.000000000000457
Further Details:      
 
Domain Number 2 Region: 44-144
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.51e-29
Family Cellulose-binding domain family II 0.0000487
Further Details:      
 
Domain Number 3 Region: 148-241
Classification Level Classification E-value
Superfamily PKD domain 0.0000576
Family PKD domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|271962487|ref|YP_003336683.1|
Domain Number - Region: 249-351
Classification Level Classification E-value
Superfamily CalX-like 0.0199
Family CalX-beta domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271962487|ref|YP_003336683.1|
Sequence length 979
Comment cellulose 1,4-beta-cellobiosidase [Streptosporangium roseum DSM 43021]
Sequence
MPRFPIRAGALPRFRRRVAALALLSLAAGTTTALAASPAVAAISCEVTYATNDWQGGFTA
NVSIKNLGDPLNGWTLGFTFPDAAQKVTQGWSATWSQSGQAVTARNLDWNGNLATGASTS
IGFNGSWSGANPKPAAFTINGTTCGGTGPVNQPPTAKITKPVAGATFTAPATVDITADAA
DGDGTVAKVEFFNGTTLLGTDTTAPYAYSWAAVPAGDYSLTAKATDDKGSATTSAPVGIS
VQANSAPAVLLTPATLAVPEGGGADLSVKLSKAPSANVTVTTARTSGDADLTVASGGSLT
FTPANWNTAQTVRVAAAEDTDQTSGSAEFTSTATGHTPAKATATEVDNDTPGGDNEYVKR
FTTMYNKLKDPANGYFSPQGVPYHSVETFMVEAPDHGHETTSEAYSYYLWLEAAYGKVTG
DWSRFNDAWASMEKYIIPATADQPTNSFYNPSKPATYAGEWDDIKQYPSKLDGGVSVGSD
PIANELKTAYGTNDVYGMHWLLDVDNTYGFGRCGDGTTKPAYINTYQRGPEESVFETIPQ
PSCDTFKHGGKNGYLDLFTGDSSYAKQWKYTNAPDADARAVQVAYWAHTWAKEQGKEAQV
ASSVTKAAKMGDYLRYAMYDKYFKKQGCTSTTCPAGTGKDSSAYLLSWYYAWGGANDTSA
GWAWRIGSSHNHSGYQNPMAAWALSSVDALKPKGATAVQDWSTSLKRQLEFYRWLQSSEG
AIAGGATNSWQGHYAAPPSTLPTFYGMAYDWQPVYHDPPSNQWFGFQAWSMERVAELYYA
TGNADAKLVLDKWVKWATDNTTVNADGTFRIPSTLVWTGQPDTWNSGNPGPNAGLHVSIR
DYTSDVGVAGSYAKVLTYYAAKSGNATAKAVAKGLLDGLWKNNQDAKGVSVPETKADYNR
LNDPVYVPPGWTGKMPNGDVIDSSSTFMSIRSFYKNDPDWPKVDAYLKGTGPVPSFNYHR
FWAQVDVAVALAEYGRLFP
Download sequence
Identical sequences D2B809
479432.Sros_0936 gi|271962487|ref|YP_003336683.1| WP_012887686.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]