SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271963004|ref|YP_003337200.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963004|ref|YP_003337200.1|
Domain Number 1 Region: 70-190
Classification Level Classification E-value
Superfamily OmpA-like 1.83e-26
Family OmpA-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271963004|ref|YP_003337200.1|
Sequence length 193
Comment OmpA/MotB domain-containing protein [Streptosporangium roseum DSM 43021]
Sequence
MSRSPESVWRVLVASLLAGGLVAGAAPAVWASPEPPADATAPVEDLLLPVDDLLAEVDSL
DGSESETKQGETVTLALTSDVLFALDRAVLTAKAAARLRGVAGRVKTESAGGVVKIVGHT
DDQGTDAYNDRLSLRRAQAVQEGLRALLSGQSVTFEATGLGERQPKVPNVVDGRPVEENR
ARNRRVEIVFTAK
Download sequence
Identical sequences D2AQB3
479432.Sros_1463 WP_012888202.1.100029 gi|271963004|ref|YP_003337200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]