SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|271963903|ref|YP_003338099.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963903|ref|YP_003338099.1|
Domain Number 1 Region: 71-148,177-245,311-445,472-587
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.55e-19
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 
Domain Number 2 Region: 544-676
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000018
Family Quinohemoprotein amine dehydrogenase B chain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271963903|ref|YP_003338099.1|
Sequence length 679
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MTLIQGIRRLTAVALAASAVLAASPPALASPSASAAPAAIEALGVPLQDVLLIGGTVAPG
PGGATVLWGVSSGSPAHLNAVDPATGAEVARYDLPGAGGAWAVDAAPDGSVYVGSYGDGR
LYRWTEQGGIRDLGRPLASENFIWTVAADSASRIYGGTSPGGRLFGYDPVNGVRDYGKLS
PAHAYVRSVAVAGGKIYAGTEAPAAVFEVDAETGASTQLPTPPGLDPAGKWAYDVNVAGG
YLYVRYSDAFPGPAHVWDIAAGAWIDRLEAAHGLDVSPPDEEGRVYMVKAGELVRYDPRS
RTVTPTGMPFTGRVANTRGIGWAELGLPDYPGRSVVGLLWRGMMFRYNPQTGARSFVQTA
VRGEPIDVTALSEGPDGRMYAGGFLNGGFAALNAKTGEREEFHTFSQSEDMTTHDGKLYV
GAYPQARVYSYDPKLPWNSAEYSPSPEPGPADNPARLFDFAADKQIRPRATVSAGRYLAV
GTMPDLGHLGGVLALWDPREGSLRTAQRHVVKDQSIVSLAYRDGVVYGGTSIHSGQSATP
PTQTEARLFAWSVRENRLLWEITPVPGKPAVPALAFDDRGRLWGIAGGEVFAVNVHARKV
VSRVTLSPSASASGQLVFSKRDRTLYGAHAGSSLFSLDPRSRRHAVLREGPVHHLAVHRS
GDVYFAEGPQLYRYDPQIR
Download sequence
Identical sequences D2B191
gi|271963903|ref|YP_003338099.1| 479432.Sros_2376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]