SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428774693|ref|YP_007166480.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428774693|ref|YP_007166480.1|
Domain Number 1 Region: 304-603
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.31e-86
Family DNA repair protein MutS, domain III 0.00000176
Further Details:      
 
Domain Number 2 Region: 605-842
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.47e-57
Family ABC transporter ATPase domain-like 0.000000774
Further Details:      
 
Domain Number 3 Region: 140-204,234-316
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 7.85e-42
Family DNA repair protein MutS, domain II 0.00032
Further Details:      
 
Domain Number 4 Region: 20-138
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.22e-36
Family DNA repair protein MutS, domain I 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428774693|ref|YP_007166480.1|
Sequence length 871
Comment DNA mismatch repair protein MutS [Halothece sp. PCC 7418]
Sequence
MQESSGKATPAYMKNADYTTLDRAQLTPMMQHYIEVKEQYPNALLLYRVGDFFECFFQDA
VTVAQQLELVLTSKESGKEIGRVPMTGVPHHALDRYTAMLVEKGYAIAVCDQVEDAAEAA
AQKRMVERKITKLLTPGTLTEEGMLHARRNNFLAALVIAGEHWGLAYTDISTGEFFTTQS
QNLETLTLELLRLHPSEILLPTNAPDIGSMLRPGEKSDQVPDFLPDHFCYTLRPQSQFRT
GEARNQLLDYFRVRSLEGMGCESLPLGVRAAGGLLFYIEETQKAHQVPLQTLKTYTITDY
LILDQQTRRNLEIVQTVRDGTYHGSLLWALDRTCTAMGGRALRRWLLQPLLDIKGITARQ
ETIAELIKQTSLRNDLRQLLRQIYDLERLSGRAGAGTANARDLRGLAESLVRLTELASLV
QQGESPFLRALQTVPPDLKTLGEKILASIVESPPQHLTEGGLIRSGVDEQLDQMQAVFAE
DKQWLAHLETSERERTGIQKLKVGYNKTFGYYLSIPRSKADLAPENYTRKQTLTNEERYI
TSELKERETRILTAKDDLNRLEYEIFADLRAEVGEQAQKIREISRAIAAIDVLGGLAELA
VYNDYCRPEMVEGRCLSIREGRHPVVEQTLPTGFFVPNSTEMGYEKQRDTPDLIILTGPN
ASGKSCYLRQVGLIQLMAQIGSFVPARSAKLGISDRVFTRVGAVDDLATGQSTFMVEMNE
TANILNHATPNSLILLDEIGRGTATFDGLSIAWAVAEYLATEVQARTIFATHYHELNELA
SILSNVANYQVTVKEMENEIIFLHQVQPGGADRSYGIEAGRLAGLPPSVISRAQQVMGQI
EKHSKIALGLRKGIAQETNPSETSMDQLDIF
Download sequence
Identical sequences K9Y5V4
WP_015224144.1.10129 gi|428774693|ref|YP_007166480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]