SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428774709|ref|YP_007166496.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428774709|ref|YP_007166496.1|
Domain Number 1 Region: 15-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.36e-23
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|428774709|ref|YP_007166496.1|
Domain Number - Region: 298-327
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00553
Family Rubredoxin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428774709|ref|YP_007166496.1|
Sequence length 451
Comment serine/threonine protein kinase [Halothece sp. PCC 7418]
Sequence
MDKPKKTVVDELGTAYELTKELGEGGQGKVFAVSGGRYAVKLLPKKSDRETLRRKLQRVR
LLPIDDLKMASPKAMLKPPRVGYVMEILTGMTPIQTLINIPVDPELYLAGGGLKRRLLLL
AQCAEIFSRLHAKGLVYSDPSPGNIFISSDVDSYEVRLIDADNLHYESDPASGVYTPSYG
APEVVKGKSGVNTLTDAYAFAVIVFQALTLIHPFIGDWVNEGEPELEDKAYQGEVPWIDD
PHDTRNQTEAGIPREIVLSPGLRKLSQQCFGEGLNDPLQRPGISQWRDKLYSAAAFTVHC
PECAMTYYPNKQRFCPWCDSPQPRFVEVRIIRWEPEKGCCEEKEHIFHRLVLEENYGLTL
TTRVIKGRTGEAGTDPLVELVLAGEKIRVRSVEDKNYLLTCEAYGIEKSASINSEKWRAF
PIYKNEKYGRWRLHFDALNAPHRVALFIDRS
Download sequence
Identical sequences K9Y716
gi|428774709|ref|YP_007166496.1| WP_015224160.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]