SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428774820|ref|YP_007166607.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428774820|ref|YP_007166607.1|
Domain Number 1 Region: 3-232,374-421
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-81
Family Tandem AAA-ATPase domain 0.000000184
Further Details:      
 
Domain Number 2 Region: 735-953
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.03e-72
Family Helical scaffold and wing domains of SecA 0.0000061
Further Details:      
 
Domain Number 3 Region: 423-531,638-733
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.71e-53
Family Tandem AAA-ATPase domain 0.00000764
Further Details:      
 
Domain Number 4 Region: 234-374
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 8.63e-44
Family Pre-protein crosslinking domain of SecA 0.0000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428774820|ref|YP_007166607.1|
Sequence length 955
Comment protein translocase subunit secA [Halothece sp. PCC 7418]
Sequence
MFLQKLFGDPNERKLKKLQPTVTEVNLYEEDIQALSDEALREKTQEFKEKLAQAKNETEE
DEIIEEILPEAFAVVREAARRVLGLRHYDVQILGGIVLHSGEIAEMKTGEGKTLVATLPC
YLNALSGKGVHVVTVNDYLARRDSEWMGQVHRFLGLSVGLIQQGMSPRERQENYACDITY
TTNSELGFDYLRDNMATSLEEVVQRPFNYCIIDEVDSVLIDEARTPLIISGQVERPTEKY
IRASEVAKELKRDREGELKTEEAVALEEAEAGQEAHYEVDEKAKSVILTDEGFAKAEELL
GVNDLYDPEDPWAHYIFNAIKAKELFIKDVNYIVRNGEVVIVDEFTGRVMPGRRWSDGLH
QAIEAKEEVEIQKETQTLASITYQNFFLLYPKLSGMTGTAKTEEAEFEKIYNLQVTIIPT
NLPLARRDLADSVYKNERGKWKSVADECQEKHEQGRPVLVGTTSVEKSELLSKLLDEREL
PYNVLNARPENVERESEIIAQAGRKGAITIATNMAGRGTDIILGGNPDYMARLKLREYFM
PKVVIPEEDDDLAVSVPNGKKRSGGQGFGGQNKKKKVKTWRASPQIFPTELSKATEQKLK
EAVDYAVQEYGLQSLPELDAEEKVAIAAEKAPTDDPVIQNLRNVYRDIYQEYEAYTSQEH
DEVVELGGLHVIGTERHESRRIDNQLRGRAGRQGDPGSTRFFLSLEDNLLRIFGGDRVSG
MMNAFRVEEDMPIESGMLTRSLENAQRKVETFYYDTRKQIFEYDEVMNNQRRAIYAERRR
VLEGKDLKDQVLEYARRTMDDIVNAYVNPELPPEEWDLESMVAKAKEFVYLLEDVEPSQM
EDMTFGEMRAFLHEEIHKAYDIKEAEVEKLQPGLMRQAERFFMLQQIDTLWREHLQAMDS
LRESVGLRGYGQRDPLVEYKQEGYEMFLEMMIDIRRNVVYSLFQFQPQVQQPQTV
Download sequence
Identical sequences K9Y8G4
WP_015224271.1.10129 gi|428774820|ref|YP_007166607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]