SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775089|ref|YP_007166876.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775089|ref|YP_007166876.1|
Domain Number 1 Region: 203-400
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.86e-65
Family B3/B4 domain of PheRS, PheT 0.00000488
Further Details:      
 
Domain Number 2 Region: 35-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.44e-46
Family Myf domain 0.0022
Further Details:      
 
Domain Number 3 Region: 490-703
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.7e-43
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00013
Further Details:      
 
Domain Number 4 Region: 715-813
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.02e-31
Family Anticodon-binding domain of PheRS 0.00035
Further Details:      
 
Domain Number 5 Region: 415-496
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000266
Family Domains B1 and B5 of PheRS-beta, PheT 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775089|ref|YP_007166876.1|
Sequence length 814
Comment phenylalanyl-tRNA synthetase subunit beta [Halothece sp. PCC 7418]
Sequence
MRVSLNWLQEFVEIDLTPEALGEILTIAGFEVEEIEYRRRFAEGVVVGKVVEKNSHPNAD
KLSVCTVDVGADEPLNIVCGAANVRAEAYVPVATVGSYLPVKDLKIKRSKLRGVKSEGMI
CSLAELGLEKESDGIYIFNDHDSLTLGEPVYPLLGLDDVVLDLTTTANRADALSMVGVAR
EVSALTGKKLTLPEIPQTEISTDQGGLGVTVTATEACPAYIATEITNLSLAPSPQWLQRR
LQAAGVRPINNVVDITNYVLLEWGQPLHAFDRERLKTGAGGEDLTLGVRFAKKGETLTTL
DGQARDLESENLIITANDVPVALAGVMGGEETEVHDQTENIILEAALFDPVAVRRSARVQ
GLRTEASTRYERGVNQAELEQASQRAIALLQELAQGTPTQQAMADHRLHPEQRQRTLTLR
LDRIQQVLGQVNNRDDGKLTPEDIKGILTALGCQLKPYNVDGGEGWEVIVPPYRDRDLER
EIDLIEEIARLYGYDYFCDTLPEQSQPGMLSVRQQNKNRIREAMRAVGLTEVLHYSLVKP
EADAVTLANPLFQEYSALRTELITGLVNAFSYNLARGNGALNAFEIGRRFWQTETGIAEA
DTLAGIMGGERFPQGRWTTSGQGQTMTWYQAKGLLDAVFNRLGVSVSYAATSEDERLHPG
RTAVISLDDQRLGLFGQLHPQFRQDHDLPEAVYVFSFDLEILLTALAEKNLSQSRFSPFS
TYPAVARDMAFYAPVDLPVAELMQVMEKAGGKLLEKVELFDEYRGENVPDGQRSLAFSLT
YQARDRTLTDEEVEPLLEKVRKALTQEFEVTLRS
Download sequence
Identical sequences K9Y837
WP_015224540.1.10129 gi|428775089|ref|YP_007166876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]