SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428775131|ref|YP_007166918.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775131|ref|YP_007166918.1|
Domain Number 1 Region: 6-233
Classification Level Classification E-value
Superfamily Ribosomal protein S2 6.93e-94
Family Ribosomal protein S2 0.000000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775131|ref|YP_007166918.1|
Sequence length 274
Comment 30S ribosomal protein S2 [Halothece sp. PCC 7418]
Sequence
MSVITLRELLESGVHFGHQTRRWHPAMRPYIYTARNGVHIIDLVQTAQLMEEAYSYLQDA
SAKGQKVLFVGTKRQAAGIIAQEASRCGAFYVNQRWLGGMLTNWETIKTRVERLKELERL
KESGAMARRPKKEAAVLGRELEKLQKYLGGIKMMRRLPDIVVIVDQRREHNAIMECQKLG
IPIISMLDTNCDPALADLPIPANDDAIRSVKLIVGKLANAIYEGRHGELDMETEAEYDEF
DEGIDTYQEEDDEEEEMTSEADSEMAAVGESEEE
Download sequence
Identical sequences K9Y7D4
gi|428775131|ref|YP_007166918.1| WP_015224582.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]