SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775237|ref|YP_007167024.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775237|ref|YP_007167024.1|
Domain Number 1 Region: 175-438
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 3.27e-82
Family Creatinase/aminopeptidase 0.000000196
Further Details:      
 
Domain Number 2 Region: 3-174
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 6.28e-53
Family Creatinase/prolidase N-terminal domain 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775237|ref|YP_007167024.1|
Sequence length 441
Comment aminopeptidase P [Halothece sp. PCC 7418]
Sequence
MSISKAEYQQRRETLMEKIGQGTAIFRSAPMAVMHNDVEYRFRQDSDFYYLTGFDEEEAV
LVLAPHHEEHQFVLFVQPKDLEKETWTGYRVGVEAAKEKFGADEAYPINELDEKLPQYLE
KADCIYYHFGRDEAFNDTVLNHWRKLVRQYQKKGIAPGAIAETNFILHPLRQVKTAEEIS
LIRKAVEIGVEAHNQALKIAKPGVYEYEVQAEIEYIFSKHGAMSPAYPSIVASGENACIL
HYIENSKQLQENDLLLIDAGCCYDYYNSDITRTFPVSGKFTGEQKAIYEIVLEAQLKAIE
QVKAGNPYNQFHDTALRVLVEGLMDLGILKGDIEEIIKEEKYKPYYMHKTGHWLGIDVHD
VGGYKLGEEHWQTLQPGNILTVEPGLYLSPHAKPAEGQPELPEKWHGIGVRIEDDVLVTT
EGNEVLSAGVPKSVEDMESKG
Download sequence
Identical sequences K9Y8S0
WP_015224688.1.10129 gi|428775237|ref|YP_007167024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]