SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775413|ref|YP_007167200.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775413|ref|YP_007167200.1|
Domain Number 1 Region: 685-946
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.41e-105
Family BC ATP-binding domain-like 0.000000222
Further Details:      
 
Domain Number 2 Region: 128-402
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.71e-105
Family BC ATP-binding domain-like 0.000000016
Further Details:      
 
Domain Number 3 Region: 397-553
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 5.1e-53
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000919
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.3e-48
Family BC N-terminal domain-like 0.00000238
Further Details:      
 
Domain Number 5 Region: 561-687
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.31e-45
Family BC N-terminal domain-like 0.000003
Further Details:      
 
Domain Number 6 Region: 948-1084
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 5.49e-36
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775413|ref|YP_007167200.1|
Sequence length 1086
Comment carbamoyl-phosphate synthase large subunit [Halothece sp. PCC 7418]
Sequence
MPRRTDLKKILVLGAGPIIIGQACEFDYSGTQACKALREEGYDVVLVNSNPATIMTDPET
TERTYIEPLTPEIVEKIIAKERPDALLPTMGGQTALNVAVDLANAGVLEAYNVDLIGAKL
PAIEMAEDRLLFKEAMARIDIPVCPSGIASSLEEAKIIAQQEIGSYPIIIRPAYTLGGSG
GGIAYNQEEFEEKAQLGLDASPVSQILIERSLLGWKEYELEVMRDLADNVVIICSIENLD
PMGVHTGDSITVAPAQTLTDKEYQRLRDYSKKIIREIGVETGGSNIQFAVNPDDGEVVVI
EMNPRVSRSSALASKATGFPIAKFAAKLAVGYTLDEIPNDITKKTPASFEPTIDYVVTKI
PRFTFEKFPGSTPNLTTQMKSVGEAMAIGRTFCESFQKALRSLETGRMGWGCTPLTSRGG
LPSITQVRASLRTATPERIFAVHHAFHLGMTVEEIHQLTSIDPWFLTNMERIIAGEKFLK
ATPLDQITAEQMREIKQLGFSDPQIAFATQTTEAAVADKRRELNVFPVYKMVDTCAAEFE
AFTPYYYSTYEVGETEVIPSEKPKVMILGGGPNRIGQGIEFDYCCCHASFSLGDAGYETI
MVNSNPETVSTDYDTSDRLYFEPLTREDVFNIIAVERPRGIIIQFGGQTPLKLAVSLEEY
LHRHQDTIPTKIWGTSPDSIDIAEDRERFEQILRQLVIDQPPNGLARSYDEALVIAGNIG
YPVVVRPSYVLGGRAMEIVYSDAELEHYMNFAVQVEPEHPILIDKFLENAIEVDVDAIAD
QEGNVVIGGIMEHIEQAGIHSGDSACSLPYVSLSETVLATIRKATAQLATALKVVGLMNI
QFAVQGETVYILEANPRASRTVPFVSKATGFPLAKLASLVMSGKTLAELNFTEEPRPDHI
AVKEAVFPFDKFPGTDVILGPEMRSTGEVMGIDYEFGKAFAKAELAAGQRLPLSGTVFVS
TNNRDKQLVIPVVKDFIELGFDIIATEGTKAALEAEGLEVGLLLKLHQGRPHVLDAIKNR
KIQLIINTPTGQEAQTDGQLIRRTALAYKIPMVTTIAGARANVAAIRALQSGSLDVKALQ
EYISAT
Download sequence
Identical sequences K9Y7S7
gi|428775413|ref|YP_007167200.1| WP_015224864.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]