SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775528|ref|YP_007167315.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428775528|ref|YP_007167315.1|
Domain Number - Region: 16-78
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0109
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428775528|ref|YP_007167315.1|
Sequence length 124
Comment hypothetical protein PCC7418_0888 [Halothece sp. PCC 7418]
Sequence
MSLLKKSKGTFLVGFGYLLSPLSWWNDLFFNLPIAYGFAYCFNWMFTDAFLLLTVVGYWL
SNILGILMMQWGTFDLFFEDRQSNLKRDLVLGLVGSTVYTVVIVLLLYFNMIQTPDFLGS
ILEP
Download sequence
Identical sequences K9Y834
gi|428775528|ref|YP_007167315.1| WP_015224978.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]