SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775653|ref|YP_007167440.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775653|ref|YP_007167440.1|
Domain Number 1 Region: 399-682
Classification Level Classification E-value
Superfamily Subtilisin-like 4.32e-81
Family Subtilases 0.00000526
Further Details:      
 
Domain Number 2 Region: 246-353
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000105
Family Collagen-binding domain 0.0063
Further Details:      
 
Domain Number 3 Region: 134-224
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000484
Family Collagen-binding domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|428775653|ref|YP_007167440.1|
Domain Number - Region: 27-119
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0209
Family Collagen-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428775653|ref|YP_007167440.1|
Sequence length 695
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Halothece sp. PCC 7418]
Sequence
MLNFLIDQKQFDDYAGDASTIGEIGISETELGTLEFSSDRDWFAIELEAGATYEFSLEGQ
TLSDPYLRLYDEAEKLILSNDDHEESLNSQLSFTPENRGTFYLEAGAFADLYTGSYQLSM
ALISTVDDYAGNTNTTGTLTIGKTQQGNLETIGDRDWFAIELEAGATYQFDLNGDSLSDP
YLRLYDEDGNFIDYEDDTNNSLDSVLSFTATSSETFYLSAGSFADVYTGSYELSAELVVA
PPPPATEPGETLNSALDLGTLNPNATLQTEDQVSQNDFLDLYRFHLDSPLSIEANLNNFS
SDLDLALLDNNGNPITFSRNDQTQNEVITETLETGSYYLAVYPYAGSSTFSLDLTARTPP
ELPDGYSSDIGYGEAQVDQALATLLNTELATVEELGDENWGIDRIGAPTAWEMGYTGEDL
VVAVLDTGVDTSHTDLQNNIWVNSDEIPSNGLDDDSNGYIDDTQGWDFANYDNDPNDVNG
HGTHVAGSIAAEDNNWGTVGVAPDAEIMPVQVLADNGLGFNSDIIAGINYAVDNGADIIN
LSLGASRATPAIHNAIQSATDAGILVVMGAGNSAGSTPDHPGAFAVEEGLVVGALNQEGD
LASFSNQAGEIPQDYEGDGLAFPRYVTAPGVDVVSTVPNDNFASLSGTSMATPHVAGSAA
LLMQADPTLTPEETVDLITATTLSQSESGGFQTLG
Download sequence
Identical sequences K9Y8H2
gi|428775653|ref|YP_007167440.1| WP_015225103.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]