SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775690|ref|YP_007167477.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775690|ref|YP_007167477.1|
Domain Number 1 Region: 228-628
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.12e-94
Family RecA protein-like (ATPase-domain) 0.0000000525
Further Details:      
 
Domain Number 2 Region: 20-177
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000000149
Family GSPII protein E N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428775690|ref|YP_007167477.1|
Sequence length 674
Comment type II secretion system protein E [Halothece sp. PCC 7418]
Sequence
MTYSSSAKKRQRALTTLRDSSPFGNKLIQAGYASSKEIEQARQQVTQSEGKQSFTEALSE
VTGKELPPELYRQYKKHHLFELKIYYGVESLDPEVTDLEEYPIAELIDDIIPLDLCRRHK
LLPLSKRDTRPPSLLVGMVNPDELTAQDDLTRILRPKGFIPQRVVMTLDDYERIIGKYLD
EQSAQQEEAEEEDQLDVTKDIANLDMEGLEEVNDDTDADLEKSLGDAQAAPIINLVNRIL
IKALKDGVSDIHIEPQEEYVRVRMRRDGVLQETFDNLPIKISPAIAARFKIMAELDIAER
RMPQDGKIRRKYKGRNVDFRVSTLPSRYGEKIVLRILDNSATQLGLDKLITDQKSLDLVR
DMASRPFGLILVTGPTGSGKSTTLYSILAERNDPGVNISTAEDPIEYALPGITQVQVIRE
KGMDFASILRSFLRQDPDIILVGETRDKETAKTAIEAALTGHLVLTTLHTNDAAGAIARL
DEMGVEPFMISGSLIGVLAQRLMRRVCSQCRIPYNPTQEELARFGLSATKEEEVTFYKAN
TLQPDEIEQARKQNKLCSKCNGVGYKGRAGVYEIMAMSETLQMLINEGAPTERIKEAAVE
EGMQTLLAYSLNLVREGYTTLDEVERVTFTDSGLEAELKAKRKSSLTCNTCSAELQPEWL
DCPYCLTPRFQDNE
Download sequence
Identical sequences K9YB00
WP_015225140.1.10129 gi|428775690|ref|YP_007167477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]