SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775701|ref|YP_007167488.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775701|ref|YP_007167488.1|
Domain Number 1 Region: 181-431
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.28e-41
Family Nitrogenase iron protein-like 0.00000265
Further Details:      
 
Domain Number 2 Region: 126-203
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.00000000000000117
Family Domain of the SRP/SRP receptor G-proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428775701|ref|YP_007167488.1|
Sequence length 433
Comment signal recognition particle-docking protein FtsY [Halothece sp. PCC 7418]
Sequence
MVFNWFRRQFNEPEEQQSQSDVPTQSQPEETTEEDSAIAPSSAVESDEKSDSKVTQEASP
STATPAWLQQSGGLEKLEETAIDDTPPAPEPTPAETATEADEESAWSAQVLANQGRKPED
ISEEEISWLKQLRRGLGKTRRNFLNQLKAVVGKGPLNDDAIMEIEALLLQADVGIEATDY
IIETLQAKMREEALPLDSAIAYLKEIVQDILERPFQEKNTPVTFAPEKDELNIWLITGVN
GAGKTTTIGKLAHLGQKSDYRCLIAAADTFRAAAVEQVKAWGDRANTEVVANPGKNTDPA
AVVYDAITKAQSQGTELLLVDTAGRLQNKKNLMEELGKIRKVIDKKAPEAKIESLLVIDA
SLGQNGLKQAEAFTEVARLSGVVLTKLDGSSKGGVALAISKQLNLPIRFVGAGEGLEDLR
PFSSYEFAEALLS
Download sequence
Identical sequences K9Y8W6
gi|428775701|ref|YP_007167488.1| WP_015225151.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]