SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775759|ref|YP_007167546.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775759|ref|YP_007167546.1|
Domain Number 1 Region: 26-219
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 8.11e-57
Family Class I glutamine amidotransferases (GAT) 0.0000072
Further Details:      
 
Domain Number 2 Region: 207-434
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.7e-53
Family N-type ATP pyrophosphatases 0.0000023
Further Details:      
 
Domain Number 3 Region: 421-541
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 2.35e-51
Family GMP synthetase C-terminal dimerisation domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428775759|ref|YP_007167546.1|
Sequence length 541
Comment GMP synthase [Halothece sp. PCC 7418]
Sequence
MTISTDSSQKSAAIEQAEITGSINRQMIAILDFGSQYSELIARRIRETQVYSEVLPYRTT
AEQLKKLNPHGIILSGGPSSVYDQGAPQVDPKIWDLGIPVIGVCYGMQVMVQQLGGVVER
AKHAEYGKASLHIDEEEILFPGVEDGATMWMSHGDSCIELPLGFQVLAHTDNTPCAAIAH
PDRKLYGVQFHPEVVHSVGGAVLIRNFVYKVCQCEPTWTSEAFVEEAVREVRAKVGEKRV
LLALSGGVDSSTLAFLLHKAIGDQLVCMFIDQGFMRKGEPERLLEIFKDRFHIPVEYVNA
RDRFLAQLEGVSDPEEKRRRIGHEFIKVFEEKSRELGPFDYLAQGTLYPDVIESADTNVD
PKTGERVAVKIKSHHNVGGLPEDLRFKLVEPLRKLFKDEVRKVGSSLGLPDEIIQRHPFP
GPGLAIRIIGEVTAERLNILRDADFVVRDEIKKQNCYQDFWQAFAVLLPIRSVGVMGDKR
TYAHPVVLRLISSEDGMTADWSRVPYDLLETISNRMVNEVKGVNRVVYDVTSKPPGTIEW
E
Download sequence
Identical sequences K9YA27
gi|428775759|ref|YP_007167546.1| WP_015225209.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]