SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775912|ref|YP_007167699.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428775912|ref|YP_007167699.1|
Domain Number - Region: 341-370
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.033
Family Rubredoxin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428775912|ref|YP_007167699.1|
Sequence length 434
Comment transposase, IS605 OrfB family [Halothece sp. PCC 7418]
Sequence
MLRAIKVRLYPTPSQQSQLNQVMGCARYWWNYALALCKQHYKDTGKGLGRTALNAYLPLL
KRQEETAFLKECPAQVLQATTLNLTKAYKNFFEGRARYPRFKSFDQRQSCQFPQHVKIVD
NKALRLPKMEGLVKAKIHRLFEDGKLKTVTISRTPTGKYYASLLFETQQEKPTPVTEGKV
AGIDLGIKEFALVHDGEKCSKFPNPKHLSKHEKNLKRKQKKLARKQKGSQSRNKARKLVA
KVHERVSNTRQDYLHKVSRKIVDNNQVVVVENPSVHLNSIQVLADGRIPRLNIKGMVRNH
KLAKAISDVSWGMFVNFLDYKLKEKGGFLVEIDRWFPSSKLCSNCHYELESLDLEVREWT
CPKCGTHHDRDENASKNIRAEGIRMLSVSGTGTAAVGGDRSPKLGRKVKFGHSPTNIEAP
TCVHRGWGSSQFPH
Download sequence
Identical sequences K9YAQ4
gi|428775912|ref|YP_007167699.1| WP_015225361.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]