SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428775997|ref|YP_007167784.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428775997|ref|YP_007167784.1|
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.4e-61
Family G proteins 0.00000014
Further Details:      
 
Domain Number 2 Region: 308-408
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.96e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000134
Further Details:      
 
Domain Number 3 Region: 215-311
Classification Level Classification E-value
Superfamily Translation proteins 1.08e-32
Family Elongation factors 0.00000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428775997|ref|YP_007167784.1|
Sequence length 409
Comment translation elongation factor 1A (EF-1A/EF-Tu) [Halothece sp. PCC 7418]
Sequence
MAREKFERTKDHANIGTVGHVDHGKTTLTAALTMTLSSSGRAKARQYEDIDAAPEEKARG
ITINTAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGISSLVVFLNKVDQVDDEELLELVELEVRELLSEYDFPGDDIPIISGSALMAVE
ELTKNPQISKGENEWVDKIYELMDAVDDYIPTPERDIDKPFLMAVEDVFSITGRGTVATG
RIERGKVKVGEEVEIVGIQDTRKSTVTGVEMFQKTLDEGMAGDNVGILLRGIQKDDIERG
MVLAKPGSITPHTQFEAEVYVLKKEEGGRHTPFFPNYRPQFFVRTTDVTGTITAFTADDG
SEAEMVMPGDRVKMTVQLISPVAIEQGMRFAIREGGRTIGAGVVSKIVA
Download sequence
Identical sequences K9YAY8
gi|428775997|ref|YP_007167784.1| WP_015225446.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]