SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428776210|ref|YP_007167997.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776210|ref|YP_007167997.1|
Domain Number 1 Region: 7-434
Classification Level Classification E-value
Superfamily Clc chloride channel 5.1e-97
Family Clc chloride channel 0.00000211
Further Details:      
 
Domain Number 2 Region: 444-567
Classification Level Classification E-value
Superfamily CBS-domain pair 1.64e-32
Family CBS-domain pair 0.00067
Further Details:      
 
Domain Number 3 Region: 599-731
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.27e-16
Family Universal stress protein-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428776210|ref|YP_007167997.1|
Sequence length 877
Comment Cl- channel voltage-gated family protein [Halothece sp. PCC 7418]
Sequence
MFSSWLKFLRLRPVDQRYALLEACLIGVISALAALTLKQGIGWLGGYRVAAVNEHGWFVL
PLAGFLFGGLTGVCLQWLAPEAAGGGIPQVKAVLAQLPMSLSLRSALVKLLGTIFILGAG
FTLGRRGPTVHIGATLAAQLSLWLPTSPQHRRQLIAAGAAAGLAAGFNTPIAGIVFVVEE
LMRDISGFTLETAILASFTGAVVSRLLESSEVNLSGLVSQQGWEVTFVSQEIPFFLLLGI
SAGLLGVIFNRGILFSLRFYQGLSWPIPLRIAVAGLISGSIVAALPPFFRDNAGLRDFLI
TGEGGWQITAIALIAYFFLTLIAYGSGAPGGLFSPALVIGSALGYLIGVAEVALVGMGSA
NINTYALAGMGAMFTAVVRVPVTAIVIIFEMTANFELVLPLMISCATAYLVAESLSRGSL
YQELLAAKGINLREETQVDPILARVSAEQVMTYPVESLSTDLTLDETSQVFSRSPHRGFP
VVEHGKLVGIITQTDLGKIMGRSQPLTLKDIMTQRPVSVSPSAPLQEVLYLLNRYHLSHL
PVTKQERLVGIITRSDIIRAEVEALHDSDTLEQPIAQRVIGEPSYTIYQTRSPAVGKGRI
LLPITNPETVIGLTEFGSAIAQYRQAELELLHLIKVPRNSAPNQAWVNPTLGRQLLQQAE
AIANQYALPVHTQLRTTHQRSEAILEVIQERKISLLIMGWKGTKNIFTGRLFGDLTGNMM
RKAPCDVVLLKRSRKVTAKDSSASQRWLIPLAVEQTNIKPLMSLLPQLSAVGNAPEYLFC
TINATEKENPFQGTVQQLSKQLQAPVQSLTLPTPTTENQVLQLATEKECDVIVLLTTFKA
TSPSFSLDTSFENNFPAIVAKRFSGTVILIRPARETK
Download sequence
Identical sequences K9YCG4
WP_015225659.1.10129 gi|428776210|ref|YP_007167997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]