SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428776227|ref|YP_007168014.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776227|ref|YP_007168014.1|
Domain Number 1 Region: 172-384
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.66e-84
Family ATP sulfurylase catalytic domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 8-170
Classification Level Classification E-value
Superfamily PUA domain-like 2.78e-53
Family ATP sulfurylase N-terminal domain 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428776227|ref|YP_007168014.1|
Sequence length 389
Comment sulfate adenylyltransferase [Halothece sp. PCC 7418]
Sequence
MSNQNDAIAPHGGQLINCIPDEAEKKEFLAQAESLPRIQLDQRAFSDLEMIAIGGFSPLR
GFMEQGDYERVVEDMHLENGLPWSIPVTLSVSEEEAEPLKEGSWIRLDDPNGRFVGVLEL
TQKYRYNKAHEAINVYRTDEEKHPGVAVIYQKGAINLAGPVWLLERDPHPLFPNYQIDPI
QSRALFREKGWKTIVGFQTRNPIHRAHEYIQKCALEVVDGLFLHPLVGATKSDDIPADVR
MRCYEIMLNNYYPKDRVTLAIYPAAMRYAGPREAIFHALVRKNYGCTHFIVGRDHAGVGD
YYGTYDAQEIFNEFDPEALGITPMRFEHAFYCKRTKQMATSKTSPSTPEERLHLSGTKVR
AMLREGQLPPEEFSRPEVAQELAKAMQKN
Download sequence
Identical sequences K9YBN7
WP_015225676.1.10129 gi|428776227|ref|YP_007168014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]