SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428776407|ref|YP_007168194.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776407|ref|YP_007168194.1|
Domain Number 1 Region: 225-487,528-694
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.12e-32
Family Tandem AAA-ATPase domain 0.061
Further Details:      
 
Domain Number 2 Region: 722-814
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.19e-23
Family Pentapeptide repeats 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428776407|ref|YP_007168194.1|
Sequence length 815
Comment pentapeptide repeat-containing protein [Halothece sp. PCC 7418]
Sequence
MTNQQFIVTEPLSQAGQSAEKKVWETIQVAFENRNCLGYWRYPIFSTGTNFRKEPDILLL
DRALGIMIIEVKGLVIDQIKQITGHLWHYQNFYTSSGNPYQQAENQLFSLLNYCHQEASL
NHQITSRVLVALPNITRREWEARTFHRLPSQPPLLLTDDFASTDHLFSKIKQTPILSQGT
DLTEKQWELLLAMFSGTPVYQKPKYRVLASPNSRGKILQQVYQQISQWDQQQEKIGKQIP
PGCQRIRGIAGSGKTALLCQKAAQMHLKHPDWEIALVFFSRSLYPVIIDQLSYWLNRFSE
AKQTFHPKNSKLRVLHAWGAKKQAGLYRLIAEAADISPLTVSDIPKPERYQPQVALALAC
DQLLTKTSIPQLFDAILIDEGQDLLVDEKIKLQTQQPFYQLAYQALRPVHPTQPQQRRLI
WTYDEAQSLDHLTIPTPGEILGEKRAHLLSGEYQDGIKKTEILSRCYRLPHPVITFAHGI
GMGLLRRKGLLTGVRHPEDWKALGYEVTGHFEPQTEIILKRPIENSPHPLPQLWSGEMIR
FQSYAVRQEELTALAEQILINLRQEGLRPSRQILVLVLGETFTARRLETEVARFLYQQGL
DIYLPSAPDCNVFETASVQRNPNQFWCEGGVTVSRIHRAKGQEADMVYIVGLDQIAKDEG
NLYLRNQLFTAITRTRAWVTLSGVGAYSFYEEVQQVLDSGETFRFIYRQPPLREIPITPV
GEFLARYTAGERNFQNIDLQGIELSHFDLKGCNFIGANLVGANLSYSCLEGAKLVVANLE
NANLSQANLCKAKLVGANLKNANLEGANLTHTDLY
Download sequence
Identical sequences K9YC57
gi|428776407|ref|YP_007168194.1| WP_015225855.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]