SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428776472|ref|YP_007168259.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428776472|ref|YP_007168259.1|
Domain Number - Region: 37-89
Classification Level Classification E-value
Superfamily GAD domain-like 0.0785
Family PH0730 C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428776472|ref|YP_007168259.1|
Sequence length 114
Comment hypothetical protein PCC7418_1877 [Halothece sp. PCC 7418]
Sequence
MSGLTRLRFKSQIRAIPAIKVIVQPWRGRHHVYGIFLLPKSYQPKKLIFLQDLTVGHYCP
QAVIRQTDLEGILIPPRYSPVKIYMKTRIALLLMSLGFNRHLQQPHHWRLTIES
Download sequence
Identical sequences K9YCB4
WP_015225920.1.10129 gi|428776472|ref|YP_007168259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]