SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428776504|ref|YP_007168291.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776504|ref|YP_007168291.1|
Domain Number 1 Region: 185-644
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-112
Family Amylase, catalytic domain 0.00000000771
Further Details:      
 
Domain Number 2 Region: 652-754
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.31e-37
Family alpha-Amylases, C-terminal beta-sheet domain 0.00045
Further Details:      
 
Domain Number 3 Region: 15-119
Classification Level Classification E-value
Superfamily E set domains 7.28e-16
Family E-set domains of sugar-utilizing enzymes 0.02
Further Details:      
 
Domain Number 4 Region: 143-200
Classification Level Classification E-value
Superfamily E set domains 0.0000000000574
Family E-set domains of sugar-utilizing enzymes 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428776504|ref|YP_007168291.1|
Sequence length 766
Comment glycogen branching protein [Halothece sp. PCC 7418]
Sequence
MSQNLTPEQVQQIVSHQHPNPFQVLGAHLIETDDQQQKWAIRAYVPHAEAVWVRLPAARE
EHPMQTQHHPQFFECILDLDGKPLINYQLRIQEKERERVIYDPYAFPSPLLTEYDRYLFS
EGNHHRIYEKLGAHPTTVKGVTGVYFATWAPNAQSIAIVGDFNDWEKGQHPMQKGENGIW
ELFIPGVEVGQCYKYIITGKNGEIEDKSDPYGFQQEVRPHTASIVTDLDTYTWGDSAWLE
KRRHRDPLQSPISVYEVHLGSWLQGSVHDPPRSLQGNVSPVTMSAENQEARFLTYYELAE
TLIPYVKELGYTHIELLPLAEHPFDGSWGYQVTAYYACTSRYGPPQDLMYFVDQCHQNGI
GVILDWVPGHFSKDIHGLALFDGTHLYEHPDPRRGEHKEWGTYVFNYARPEVKNFLVANA
LFWLDKYHLDGLRVDAVASMLYLDYQRQEGEWLPNEFGGRENLDAVAFLRQTNYLLFSYF
PGVVSIAEESTAWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNLTFS
MWYHHSENYMLALSHDEVVHGKSHILGKMPGDEWQKFANVRCLFAFMFTHPGKKTLFASM
EFGQWNEWDETTPLDWWLLEYPLHSRLKQYVGDLNNLYRQQPALYEQDFMDEGFSWIDCN
DHRHSVISFIRRAQDPSDFLLVVCNFTPQPHSHYRVGVPTAGFYQEIFNSDSREYGGSNM
GNLGGKWTEEWTFHEQPYSLDLCLPPLAVTIFKLDAEKTRETDSSR
Download sequence
Identical sequences K9YC78
gi|428776504|ref|YP_007168291.1| WP_015225952.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]