SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428776519|ref|YP_007168306.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776519|ref|YP_007168306.1|
Domain Number 1 Region: 473-641
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.42e-44
Family Tyrosine-dependent oxidoreductases 0.0000014
Further Details:      
 
Domain Number 2 Region: 1-144
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.54e-40
Family Tyrosine-dependent oxidoreductases 0.00000428
Further Details:      
 
Domain Number 3 Region: 142-239,437-475
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000000000000173
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.017
Further Details:      
 
Domain Number 4 Region: 356-433
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000221
Family Intein endonuclease 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428776519|ref|YP_007168306.1|
Sequence length 648
Comment NAD-dependent epimerase/dehydratase [Halothece sp. PCC 7418]
Sequence
MRILVTGGAGFIGSHLIDRLMSEGHEVICLDNFYTGRKDNIKHWLNNPYFEAIRHDITEP
IRLEVDQVYHLACPASPIHYQFNPVKTVKTNVMGTLHMLGLAKRVKARFLLASTSEVYGD
PEVHPQPEEYRGNVSCTGIRSCYDRETEILTATGWTPFPELSPDVPVATLNPDNQVEYHV
PDEYIVQPYVGHLLRFANGKYDFCVTPNHKMYVRSKTGKLRFLQADESRHWNAWKVLTGG
TFSGEEQEWFTLESPPRNAKINVPQVAMDTWLEFLGYYISEGCVHVRRRERVVNGRNYNV
ADYNILIAQENPEKRERIAQCLQKMGFKFFQSDHHQFRICSQQLANILSPLGKSGDKYIP
REYLRLSPRQSRILLDALLLGDGSPRGDAYCYYTKSKQLADDVQELALRCGFAANISSHA
KYNRDLYCVNIRNPIEAALTPPEKIPYSGNVYCVNVTNHVIFVRRNGKVALCGNCYDEGK
RIAETLAFDYHRDNGVDIRVARIFNTYGPRMLENDGRVVSNFVAQSLRNEPITVYGDGSQ
TRSFCYVSDLVDGLIRLMNGDYIGPVNLGNPGEYTILELAQMIQNMINPELEIAYKPLPE
DDPRKRQPDITKAKEILGWEPRVPLQTGLEFLIEDFRDRYSFHSVTQK
Download sequence
Identical sequences K9YC96
WP_015225967.1.10129 gi|428776519|ref|YP_007168306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]