SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428776701|ref|YP_007168488.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776701|ref|YP_007168488.1|
Domain Number 1 Region: 25-260
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.07e-68
Family Alanine racemase-like, N-terminal domain 0.000018
Further Details:      
 
Domain Number 2 Region: 254-386
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.03e-49
Family Alanine racemase 0.0000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428776701|ref|YP_007168488.1|
Sequence length 387
Comment alanine racemase [Halothece sp. PCC 7418]
Sequence
MVLSQNGVEVYSQSSLNTDRAWVEINENALSHNVKAIKQLLSPDTRLMAVVKADAYGHGA
VKVAKTVIAAGGDAFAVATLQEGIDLRLAEITAPILVLGAINTVEEIQALSRWYLEPTLC
SPQQGRFFAETLREMGKTLPVHLKLDTGMSRLGVLWEDAVAFVSEIQAYPELEIKSVYSH
LATADEKDDTFMRLQQNRFDSAIAQLKTINFTPPCLHLANSAATLRDANFHYDLVRVGLA
LYGLSPSPELAGITPLKPALQVKARITQIKDLPAGAGVSYGHQFVTDRPCRIAVVGIGYA
DGVPRNLSNRLQVLLKGKKVSQIGAITMDQLMLDVTDCENVQAGDLVTLIGEERNQTITA
DDWAQALGTISWEILCGFKHRLPRIIT
Download sequence
Identical sequences K9YBP8
gi|428776701|ref|YP_007168488.1| WP_015226149.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]