SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428776991|ref|YP_007168778.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428776991|ref|YP_007168778.1|
Domain Number 1 Region: 16-202
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.71e-46
Family Methylesterase CheB, C-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 279-473
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.97e-44
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00041
Further Details:      
 
Domain Number 3 Region: 213-282
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000000275
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0081
Further Details:      
 
Domain Number 4 Region: 721-840
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000324
Family Heme-binding PAS domain 0.085
Further Details:      
 
Weak hits

Sequence:  gi|428776991|ref|YP_007168778.1|
Domain Number - Region: 649-739
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00903
Family Nucleotide and nucleoside kinases 0.083
Further Details:      
 
Domain Number - Region: 840-905
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0105
Family Heme-binding PAS domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428776991|ref|YP_007168778.1|
Sequence length 972
Comment MCP methyltransferase/methylesterase [Halothece sp. PCC 7418]
Sequence
MSSQGKTDLQNTKNPNNTFPIVAIGASAGGLEALENFFSQVTTDSEMAYLVLVHSSLEHP
HFLPEILQRTTSVPISIAENGNQIFPNHIYMIPSQMRVRVEQDCIYLSSVERRELLLTID
MFFIALAENEPQRTVGVILSGMGSDGTLGVKALKAQEALILVQSPETSAYTEMPDSAIST
GVVDGILPPAEMPRLIEQYFQQQGITEEEITAQEWLSEIFSLIRAQIGHDFSSYKQNTLL
RRIKRRMTLHQIETYAEYFNFLQDHPKEVNNLFREFLIGVTSFFREESAFEFLQQEVLPP
ILQSIPDGGTFRAWVSGCSSGEEVYSLAMILRELIDEMPKQINLQLFGTDIDQLAIDRAR
EGLFPASIATDVSQQRLRRFFRREGQFYRVSRDIRYSVVFSLQDVLKDPPFSRLNLLSCR
NLLIYLNEEAQRRLLPLFHYTLQPSGILMLGGSESIGSFQNLFHTLDLKHKIFQRREVAR
SLRQSVHFPTGAFLNLARPRRSGMTSRQNEDQNFERLIQNILLEEYSPTAVLIESNGQIL
HVQGRTGKFLETVSGPPTNNIFDMAREGLRVELASAIRSAISSGEMITRQQIPVRSNGQR
ELVKFSVKPLTMPEGLAGRLLVLLEVLDTALTDENEDNTAQSLSMQQRDGRIAELERELQ
NTRESHQTTIEELESSNEELQATNEELESSNEELQATNEELESSKEELQSLNEELQTLNE
ELQTKVEELSAAEDDMRNLLNSTSIATIFVDQQLQVKRFTPQAREIVNLIQNDVGRPLED
IATNLQEVELGAELQEVLDTLHSKVEAVQNHDGTWYQMRIMPYQTTDNRIEGAILTFTNI
DDLKQIEAEIASINVELEQIKIVILDILEANTSPLILIDPDQKIVRANQAFHEFMNLRLG
TNLQSLEQALSQQIGDFLQGNEDFSDVPFLYTASEQNECYYRVDGKVIGDVFNGNYYFLL
AFYEGDNNNLDN
Download sequence
Identical sequences K9YCH2
gi|428776991|ref|YP_007168778.1| WP_015226438.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]