SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777022|ref|YP_007168809.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777022|ref|YP_007168809.1|
Domain Number 1 Region: 30-491
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 7.59e-173
Family Type II DNA topoisomerase 0.000000000382
Further Details:      
 
Domain Number 2 Region: 503-845
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.31e-95
Family GyrA/ParC C-terminal domain-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777022|ref|YP_007168809.1|
Sequence length 848
Comment DNA gyrase subunit A [Halothece sp. PCC 7418]
Sequence
MAPSQERIIPTELRNEMSQCYLEYAMSVIVGRALPDARDGLKPVHRRILYAMYELGLTAD
RPFRKCARVVGEVLGKYHPHGDTAVYEALVRMAQLFSMRDPLINGHGNFGSIDNDPPAAM
RYTECRLQALSTDALLQDIESDTVDFIDNFDGSQQEPMVLPSRVPQLLLNGSSGIAVGMA
TNIPPHNLGELVDGAIALIHNPELTTTELMQYIPGPDFPTGGQILGRSGIKSAYAEGRGS
ITMRGVAEIETLSQAGRQDKEAIIVTELPYQSNKAAIIEKIAELVNDKKIEGISDIRDES
DRTGMRIVIELRRDAYPRVVLNNLYKQTPLQMNFGANMLALVNGEPQHLNLKKFLEVFIE
FRVETITRRTRYLLQKAQERDHLLQGLLIALQDIEAVIRIIRGAADTPTAKASLVEHFGL
SEVQTDAILQMQLRRLTALEAEKIEAEHQDLLAKISDYQDILARRERIEEIIQTELTQIK
EKYATPRRTIIESAEGEIVDLDLIANEQAIILVTEQGYIKRMPVNTFGSQNRATRGKSAT
KMKEDDEIEHFISCCDHDHLLFFSDRGVVYALSAYQVPIGSRTARGTPLLQMLPISQEEK
ITTVLAVREFTEEDYLIMLTRQGNIKKTSLSAFSNIRTNGLIAISLADEDQLRWVRLAKE
SDSIIIGSRKGMAIHFRASHEQLRPLGRATRGVKAMKLKPDDELISMDILPAQVIAEMKE
ENSEEEEATQEFTQPETLWILAITKGGYGKRVPITQFRLQNRAGKGLSAMKFRKQDCLAA
LKVVHEGEELMLVTNRGIIIRQGSDAIPRQSRQATGVRVQRLDDDDAIAAVALVPPAEED
EEEEGESE
Download sequence
Identical sequences K9YDW2
WP_015226469.1.10129 gi|428777022|ref|YP_007168809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]