SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777256|ref|YP_007169043.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777256|ref|YP_007169043.1|
Domain Number 1 Region: 5-247
Classification Level Classification E-value
Superfamily Folate-binding domain 6.75e-61
Family Aminomethyltransferase folate-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777256|ref|YP_007169043.1|
Sequence length 323
Comment folate-binding protein YgfZ [Halothece sp. PCC 7418]
Sequence
MSRHSEEKHIARNNVGLYPHSHSGIIELTGEDRLQFLHNQTTNDIKNLKAGQGCEAVFVN
STGRTLDLATVYVTEEKIFLLVSAARTQFLMEWMDRYLFPMDRVSLKNVSEVYSVSSLMG
EKSPALMEQLGATINLDQPFATHEMTTINEIPVRVAVGTELAIVGYTLIVASEQGSVLQE
TLTEAGAVMISEAVWDELSLEQGRPLPDYELTEDYNPLEAGLWKAISFDKGCYIGQETIA
RLHTYQGVKQRLWGLHLSQPVDPETPITLDGKKVGKLTRLLETEDGVKGLGYIRTKAGGE
GLNVNIGDAEAKVIAVPFLTHPQ
Download sequence
Identical sequences K9YDA3
gi|428777256|ref|YP_007169043.1| WP_015226702.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]